close

SimulationCraft 504-4

for World of Warcraft 5.0.4 Live (build level 15972)

Beta Release

Table of Contents

Raid Summary

 

DPS Chart

Warlock_Demonology_T14H : 122062 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active
122061.8 122061.8 nan / nan% 4637 / 3.8% 11.3 6796.5 6271.4 Mana 0.00% 58.7 100.0%
Talents http://us.battle.net/wow/en/game/mists-of-pandaria/feature/talent-specification#VZ!2...1.
Glyphs
  • imp_swarm
  • shadow_bolt

Charts

http://0.chart.apis.google.com/chart?chs=550x240&cht=bhg&chf=bg,s,333333&chd=t:948853|708244|80301|55937|52751|33605|11591&chds=0,1897706&chco=C79C6E,9482C9,435133,C41F3B,FF6F00,9482C9,9482C9&chm=t++948853++summon_doomguard,C79C6E,0,0,15|t++708244++doom,9482C9,1,0,15|t++80301++hand_of_guldan,435133,2,0,15|t++55937++soul_fire,C41F3B,3,0,15|t++52751++touch_of_chaos,FF6F00,4,0,15|t++33605++shadow_bolt,9482C9,5,0,15|t++11591++melee,9482C9,6,0,15&chtt=Warlock_Demonology_T14H Damage Per Execute Time&&chts=dddddd,18 http://1.chart.apis.google.com/chart?chs=550x275&cht=p&chf=bg,s,333333&chd=t:21,20,19,17,16,15,11,7,6,6,6,4,3,3,3,2&chds=0,100&chdls=ffffff&chco=C41F3B,FF6F00,9482C9,C79C6E,C41F3B,9482C9,9482C9,C79C6E,C79C6E,9482C9,435133,C79C6E,9482C9,C79C6E,435133,C79C6E&chl=soul_fire|touch_of_chaos|doom|felguard: melee|wild_imp: firebolt|corruption|shadow_bolt|felguard: felstorm|felguard: legion_strike|melee|shadowflame|service_felguard: melee|doomguard: doom_bolt|service_felguard: felstorm|hand_of_guldan|service_felguard: legion_strike&chtt=Warlock_Demonology_T14H Damage Sources&chts=dddddd,18
http://3.chart.apis.google.com/chart?chs=525x185&cht=lc&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chg=100,20&chd=s:ttvx24556656877654210yyvtpljjgecbZZZaaaaaYYXZYYYXWWVXXXWWUUUVWVWWTTTUUUUVUUVWWWWWUVVWWWYYWXXXWWVVVWWWXXWVVVVVVVWXYZZabbaaaaZZZaabaaaZYYXWVUUUTTTSSSSRRQQQQRRRSSTTTUUVVVVWWVVWWWWWVVVVUTTUUTTTTTTTSSSTTTTTTTUUTTUVWWWWWWVVUUTUUUUTTTTSRQQRSTUVWXYYXYYZZaabbbccaZYYYWWVVVUUUTTTTUTTTTTTSSSTTTTTTTUTTTTTTUUVVVVVUUUUUUUUUUUUTUUVVWWXXXXXXXYZZZZZZYYXXWVVVVUUTTTSSRRRRSSTUUVWWXXYYYZZZaaaaaaZZZYYYYXXXYYXYYYYYYYYYYYYZZZZZZZZZZZYYZZZZYYYXWVVVVVUUUTTSSSSSSSSSSSSSRRRSSTTTTTTTTTTTTUUUUUUTTTTUUWWXZabcdeeffghijjjkjiihgfedcbaZYXXWVVUUTTSSSRRRRSSSSSSRRRRRRSSSSSSSSSSSSSSSSSRRRRRRRRQQQ&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=563|1:|0|avg=122062|max=304431&chxp=1,1,40,100&chtt=Warlock_Demonology_T14H DPS Timeline&chts=dddddd,18 http://6.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chxs=0,ffffff|1,ffffff&chd=t:1,3,3,9,14,18,31,55,85,131,140,181,282,328,360,432,453,517,523,575,572,579,534,466,503,461,451,378,345,280,274,216,163,124,120,103,71,57,33,38,22,14,19,9,8,11,3,0,3,2&chds=0,579&chbh=5&chxt=x&chxl=0:|min=113246|avg=122062|max=133369&chxp=0,1,44,100&chtt=Warlock_Demonology_T14H DPS Distribution&chts=dddddd,18 http://2.chart.apis.google.com/chart?chs=525x275&cht=p&chf=bg,s,333333&chd=t:29.3,28.8,25.3,8.0,3.6,2.0,1.5,1.2,0.3&chds=0,100&chdls=ffffff&chco=FF6F00,C41F3B,9482C9,435133,9482C9,9482C9,9482C9,C79C6E,C79C6E&chl=touch_of_chaos 131.8s|soul_fire 129.3s|shadow_bolt 113.5s|hand_of_guldan 35.9s|life_tap 16.2s|doom 9.0s|corruption 6.7s|imp_swarm 5.4s|summon_doomguard 1.2s&chtt=Warlock_Demonology_T14H Spent Time&chts=dddddd,18

Abilities

Damage Stats DPS DPS%% Count Interval DPE DPET Hit Crit Avg Crit%% Avoid%% G%% B%% Ticks T-Hit T-Crit T-Avg T-Crit%% T-Avoid%% Up%%
Warlock_Demonology_T14H 122062
blood_fury 0 0.0% 4.3 120.84sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: blood_fury

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 4.30 4.30 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
none 4.30 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: blood_fury

Static Values
  • id:33702
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:33702
  • name:Blood Fury
  • school:physical
  • tooltip:Spell power increased by $s2.
  • description:Increases your spell power by $s2. Lasts $d.
cancel_metamorphosis 0 0.0% 10.7 29.69sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: cancel_metamorphosis

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 10.68 10.68 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
none 10.68 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: cancel_metamorphosis

Static Values
  • id:0
  • school:unknown
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:dot.corruption.remains>15&buff.dark_soul.down&demonic_fury<=750&target.time_to_die>30
corruption 11440 9.4% 5.6 93.59sec 915482 764455 0 0 0 0.0% 0.0% 0.0% 0.0% 294.6 14658 30586 17437 17.4% 0.0% 96.9%

Stats details: corruption

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 5.61 5.61 294.60 294.60 1.1976 1.4782 5137137.47 5137137.47 0.00 11617.07 764454.98
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 5.61 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 243.2 82.55% 14658.35 9002 27945 14665.57 13586 16014 3564926 3564926 0.00
crit 51.4 17.45% 30586.05 18544 57567 30605.91 25742 35842 1572212 1572212 0.00
DPS Timeline Chart

Action details: corruption

Static Values
  • id:172
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3750.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(!ticking|remains=6&miss_react
Spelldata
  • id:172
  • name:Corruption
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $?$W2=2[${$t1/2000}.2][$t1] sec.
  • description:Corrupts the target, causing $o3 Shadow damage over $d.$?a104315[ Generates 4 Demonic Fury each time it deals damage.][]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.200000
  • base_td:213.64
  • num_ticks:9
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_EXTEND
dark_soul 0 0.0% 6.1 80.81sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: dark_soul

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 6.05 6.05 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
none 6.05 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: dark_soul

Static Values
  • id:113861
  • school:shadow
  • resource:mana
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:15000.0
  • cooldown:80.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:113861
  • name:Dark Soul: Knowledge
  • school:shadow
  • tooltip:Mastery increased by $s1.
  • description:Your soul is infused with demonic knowledge, increasing your Mastery by ${$113861m1} for $113861d.$?s56228[ |cFFFFFFFFPassive:|r Increases your Mastery by ${$113861m1/$56228m1}. This effect is disabled while on cooldown.][]
doom 14265 11.7% 8.7 49.68sec 733876 708244 0 0 0 0.0% 0.0% 0.0% 0.0% 41.8 128174 269203 153268 17.8% 0.0% 98.2%

Stats details: doom

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 8.72 8.72 41.77 41.77 1.0362 10.5665 6401817.71 6401817.71 0.00 14213.97 708244.02
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 8.72 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 34.3 82.21% 128174.44 74714 177826 128228.22 103521 147994 4401126 4401126 0.00
crit 7.4 17.79% 269203.30 153911 366321 269247.58 0 366321 2000692 2000692 0.00
DPS Timeline Chart

Action details: doom

Static Values
  • id:603
  • school:shadow
  • resource:demonic_fury
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:60.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(!ticking|remains=30&miss_react
Spelldata
  • id:603
  • name:Doom
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $?$W2=2[${$t1/2000}.2][$t1] sec.
  • description:Inflicts impending doom upon the target, causing ${($m1+$SP*1)*4} Shadow damage over $d. When Doom critically strikes, a Wild Imp will be summoned to attack the target.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:1.400000
  • base_td:1495.48
  • num_ticks:4
  • base_tick_time:15.00
  • hasted_ticks:true
  • dot_behavior:DOT_EXTEND
hand_of_guldan 6419 5.3% 30.7 14.59sec 93885 80301 11948 24824 14187 17.4% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: hand_of_guldan

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 30.68 61.10 0.00 0.00 1.1692 0.0000 866868.99 866868.99 0.00 80301.42 80301.42
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 50.48 82.61% 11947.94 0 38533 11954.05 9070 14990 603110 603110 0.00
crit 10.63 17.39% 24823.64 0 79377 24843.38 0 57270 263759 263759 0.00
DPS Timeline Chart

Action details: hand_of_guldan

Static Values
  • id:105174
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:1.3000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:15000.0
  • cooldown:15.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!in_flight&dot.shadowflame.remains
Spelldata
  • id:105174
  • name:Hand of Gul'dan
  • school:shadow
  • tooltip:(null)
  • description:Summons a falling meteor to strike the target and all enemies within $86040A1 yards for $86040s1 Shadow damage and inflicting them with Shadowflame. $@spellicon47960 $@spellname47960 $@spelldesc47960
imp_swarm 0 0.0% 5.3 93.80sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: imp_swarm

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 5.25 5.25 0.00 0.00 1.0360 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
none 5.25 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: imp_swarm

Static Values
  • id:104316
  • school:physical
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:96.40
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:104316
  • name:Imp Swarm
  • school:physical
  • tooltip:(null)
  • description:Summons $104316s1 $104316lWild Imp:Wild Imps; from the Twisting Nether to attack the target. The Wild Imps passive effect is disabled while Imp Swarm is on cooldown. Imp Swarm's cooldown is reduced by spell haste. Also increases Wild Imp's cooldown by $s3 sec.
life_tap 0 0.0% 13.7 31.02sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: life_tap

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 13.70 13.70 0.00 0.00 1.1834 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
none 13.70 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: life_tap

Static Values
  • id:1454
  • school:shadow
  • resource:health
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:mana.pct<50
Spelldata
  • id:1454
  • name:Life Tap
  • school:shadow
  • tooltip:Absorbs $w3 healing.
  • description:$?s63320[Places a stacking heal absorb effect on you for $d equal to $m3% of your total health and restores][Restores] ${$m1*$MHP*0.01} mana.$?s63320[ Lasts $d.][]
melee 4817 3.9% 253.5 1.76sec 8527 11591 7183 15066 8567 17.6% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 253.49 252.30 0.00 0.00 0.7357 0.0000 2161570.30 2161570.30 0.00 11591.25 11591.25
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 207.99 82.44% 7182.79 5337 12702 7186.02 6650 7715 1493921 1493921 0.00
crit 44.31 17.56% 15066.40 10994 26167 15074.70 12777 18048 667650 667650 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:103988
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:103988
  • name:Melee
  • school:shadow
  • tooltip:(null)
  • description:Your melee attacks become long ranged and deal Shadow.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.100000
  • base_dd_min:101.48
  • base_dd_max:112.16
metamorphosis 0 0.0% 29.5 15.47sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: metamorphosis

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 29.52 29.52 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
none 29.52 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: metamorphosis

Static Values
  • id:103958
  • school:physical
  • resource:demonic_fury
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:10.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:103958
  • name:Metamorphosis
  • school:physical
  • tooltip:Demon Form. Damage dealt increased by $103958w2%.
  • description:Temporarily transform into a demon, increasing damage dealt by ${$104315m1*$m3/100+$77219m1*$m3/100}.2%. $?!s124917|!s124913[ Metamorphosis prevents the use of ][]$?!s124913[Corruption and ][]$?!s124917[Hand of Gul'dan.][]
service_felguard 6916 5.7% 4.3 120.85sec 720092 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: service_felguard

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 4.30 4.30 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
none 4.30 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: service_felguard

Static Values
  • id:108501
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.grimoire_of_service.enabled
Spelldata
  • id:108501
  • name:Grimoire of Service
  • school:physical
  • tooltip:(null)
  • description:Instantly summon a second demon, who fights for $s1 sec.
shadow_bolt 8477 7.0% 177.8 5.65sec 21447 33605 18110 37576 21447 17.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 177.85 177.85 0.00 0.00 0.6382 0.0000 3814273.39 3814273.39 0.00 33604.75 33604.75
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 147.36 82.86% 18109.60 16162 28254 18110.23 17004 19523 2668628 2668628 0.00
crit 30.49 17.14% 37575.83 33294 58204 37575.03 33630 42734 1145646 1145646 0.00
DPS Timeline Chart

Action details: shadow_bolt

Static Values
  • id:686
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:16500.0
  • cooldown:0.00
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:686
  • name:Shadow Bolt
  • school:shadow
  • tooltip:(null)
  • description:Sends a shadowy bolt at the enemy, causing $s3 Shadow damage.$?a104315[ Generates 25 Demonic Fury.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:1.163000
  • base_dd_min:1242.32
  • base_dd_max:1242.32
shadowflame 4490 3.7% 30.5 14.59sec 65915 0 0 0 0 17.3% 0.0% 0.0% 0.0% 241.9 7008 14574 8324 17.4% 0.0% 39.2%

Stats details: shadowflame

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 30.55 30.55 241.90 241.90 0.0000 0.7290 2013542.78 2013542.78 0.00 11417.81 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 25.27 82.71% 0.00 0 0 0.00 0 0 0 0 0.00
crit 5.28 17.29% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 199.8 82.61% 7008.02 5605 19050 7015.77 6326 8200 1400363 1400363 0.00
crit 42.1 17.39% 14574.19 11546 39243 14589.27 12569 18839 613180 613180 0.00
DPS Timeline Chart

Action details: shadowflame

Static Values
  • id:47960
  • school:shadowflame
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:47960
  • name:Shadowflame
  • school:shadowflame
  • tooltip:Deals $w1 Shadowflame damage every $t1 sec. Movement speed reduced by $w2%.
  • description:Reduces movement speed by $47960s2% and deals $47960o1 Shadowflame damage over $47960d. Generates 2 Demonic Fury every time it deals damage.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.137000
  • base_td:146.34
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
soul_fire 16104 13.2% 83.9 5.19sec 86157 55937 0 86964 86964 100.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: soul_fire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 83.93 83.15 0.00 0.00 1.5402 0.0000 7230939.32 7230939.32 0.00 55937.15 55937.15
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
crit 83.15 100.00% 86963.53 68762 211368 87001.89 80868 95934 7230939 7230939 0.00
DPS Timeline Chart

Action details: soul_fire

Static Values
  • id:6353
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:24.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:45000.0
  • cooldown:0.00
  • base_execute_time:4.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.molten_core.react&(buff.metamorphosis.down|target.health.pct<25)
Spelldata
  • id:6353
  • name:Soul Fire
  • school:fire
  • tooltip:(null)
  • description:Burn the enemy's soul, causing $s1 Fire damage.$?s108869&1=0[ If used on a target below 25% health, the attack will trigger Molten Core.][] Soul Fire always critically strikes. In addition, the damage is increased by your critical strike chance.$?a104315&!a54879[ Generates 30 Demonic Fury.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:0.683000
  • base_dd_min:656.62
  • base_dd_max:802.54
summon_doomguard 2663 2.1% 1.0 nansec 1177527 948853 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: summon_doomguard

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 1.00 2.00 0.00 0.00 1.2410 0.0000 0.00 0.00 0.00 948853.01 948853.01
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
none 2.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: summon_doomguard

Static Values
  • id:18540
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:75000.0
  • cooldown:600.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:18540
  • name:Summon Doomguard
  • school:shadow
  • tooltip:(null)
  • description:Summons a Doomguard to attack the target for $60478d. Doomguard will cast Doom Bolt until it departs. $@spelltooltip85692
touch_of_chaos 15485 12.7% 127.2 3.39sec 54664 52751 45923 96037 54678 17.5% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: touch_of_chaos

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 127.19 127.16 0.00 0.00 1.0363 0.0000 6952652.19 6952652.19 0.00 52751.13 52751.13
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 104.94 82.53% 45922.94 34566 82270 45952.61 41894 49731 4819199 4819199 0.00
crit 22.21 17.47% 96036.59 71206 169476 96111.25 73502 127196 2133453 2133453 0.00
DPS Timeline Chart

Action details: touch_of_chaos

Static Values
  • id:103964
  • school:chaos
  • resource:demonic_fury
  • range:40.0
  • travel_speed:120.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:40.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:103964
  • name:Touch of Chaos
  • school:chaos
  • tooltip:(null)
  • description:Unleashes energy at the enemy, causing $s1 Chaos damage and extending the duration of Corruption.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.635000
  • base_dd_min:644.39
  • base_dd_max:712.22
pet - doomguard 19625 / 2663
doom_bolt 19625 2.1% 21.3 2.76sec 55255 19901 46524 95851 55255 17.7% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: doom_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 21.31 21.31 0.00 0.00 2.7765 0.0000 1177526.58 1177526.58 0.00 19901.07 19901.07
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 17.54 82.30% 46524.45 37536 70716 46513.51 39425 52378 815978 815978 0.00
crit 3.77 17.70% 95850.54 75072 141432 94403.23 0 141432 361548 361548 0.00
DPS Timeline Chart

Action details: doom_bolt

Static Values
  • id:85692
  • school:shadow
  • resource:energy
  • range:30.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:35.0
  • cooldown:0.00
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:85692
  • name:Doom Bolt
  • school:shadow
  • tooltip:(null)
  • description:Sends a shadowy bolt at the enemy, causing $s1 Shadow damage. Deals $s2% additional damage to targets below 20% health.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.900000
  • base_dd_min:913.31
  • base_dd_max:1009.45
pet - felguard 23409 / 23409
felstorm 5324 4.4% 10.3 45.79sec 231875 0 17067 34511 20099 17.4% 0.0% 0.0% 0.0% 71.6 25849 52268 30459 17.4% 0.0% 13.6%

Stats details: felstorm

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 10.30 10.30 71.64 71.64 0.0000 0.8562 2389078.69 2389078.69 0.00 38951.31 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 8.51 82.62% 17067.06 14490 23984 17067.20 14490 19377 145287 145287 0.00
crit 1.79 17.38% 34510.66 28980 47968 29693.51 0 47968 61795 61795 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 59.1 82.55% 25849.17 21735 40511 25863.27 24278 27345 1528660 1528660 0.00
crit 12.5 17.45% 52267.77 43470 81022 52301.24 44406 66005 653337 653337 0.00
DPS Timeline Chart

Action details: felstorm

Static Values
  • id:89751
  • school:physical
  • resource:energy
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:60.0
  • cooldown:45.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:89751
  • name:Felstorm
  • school:physical
  • tooltip:Striking for $89753m1% weapon damage every $t1 sec. Unable to use abilities during Felstorm.
  • description:The Felguard recklessly swings its weapon, striking all nearby targets within $89753A1 yards for $89753m1% weapon damage every $89751t1 sec for $89751d. The Felguard cannot perform any other abilities during Felstorm.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:true
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_CLIP
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00

Action details: felstorm_tick

Static Values
  • id:89753
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:89753
  • name:Felstorm
  • school:physical
  • tooltip:(null)
  • description:$@spelldesc89751
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.50
legion_strike 4840 4.0% 87.3 5.17sec 24900 24029 21137 42746 24900 17.4% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: legion_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 87.25 87.25 0.00 0.00 1.0363 0.0000 2172571.04 2172571.04 0.00 24028.88 24028.88
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 72.06 82.59% 21137.07 18113 33759 21146.34 20265 22038 1523086 1523086 0.00
crit 15.19 17.41% 42746.41 36225 67519 42771.84 36225 55681 649485 649485 0.00
DPS Timeline Chart

Action details: legion_strike

Static Values
  • id:30213
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:60.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:30213
  • name:Legion Strike
  • school:physical
  • tooltip:Effectiveness of any healing reduced by $w4%.
  • description:A sweeping attack that does $s2% of the Felguard's weapon damage divided among all targets within $A2 yards. The Felguard's current target is also wounded, reducing the effectiveness of any healing received by $s4% for $30213d.$?a104315[ Master gains $s3 Demonic Fury.][] |cFF777777(Right-Click to toggle)|r
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.25
melee 13245 10.9% 315.9 1.42sec 18825 13255 16839 34035 18825 17.4% 0.0% 24.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 315.94 315.94 0.00 0.00 1.4202 0.0000 5947676.84 5947676.84 0.00 13255.44 13255.44
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 185.18 58.61% 16838.78 14490 27007 16845.21 16310 17508 3118125 3118125 0.00
crit 54.92 17.38% 34035.39 28980 54015 34051.02 31536 37009 1869203 1869203 0.00
glance 75.85 24.01% 12661.23 10868 20256 12666.50 11896 13532 960348 960348 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
pet - wild_imp 30111 / 12067
firebolt 30111 9.9% 338.4 1.38sec 15999 7853 15055 30746 17836 17.7% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: firebolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 338.43 303.58 0.00 0.00 2.0373 0.0000 5414707.24 5414707.24 0.00 7853.17 7853.17
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 249.77 82.28% 15055.24 12512 23571 15077.23 14184 16277 3760352 3760352 0.00
crit 53.81 17.72% 30745.82 25023 47143 30792.55 27042 36092 1654355 1654355 0.00
DPS Timeline Chart

Action details: firebolt

Static Values
  • id:104318
  • school:fire
  • resource:energy
  • range:40.0
  • travel_speed:16.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:104318
  • name:Firebolt
  • school:fire
  • tooltip:(null)
  • description:Deals $s1 Fire damage to a target.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.300000
  • base_dd_min:312.45
  • base_dd_max:328.47
pet - service_felguard 37224 / 6916
felstorm 13924 2.1% 4.3 120.84sec 269359 0 18976 38513 22499 18.0% 0.0% 0.0% 0.0% 29.9 29962 60411 35568 18.4% 0.0% 30.6%

Stats details: felstorm

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 4.30 4.30 29.87 29.87 0.0000 0.8559 1159157.99 1159157.99 0.00 45343.37 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 3.53 81.97% 18976.18 14490 24422 18972.76 0 23984 66938 66938 0.00
crit 0.78 18.03% 38513.14 28980 48844 21927.50 0 48844 29882 29882 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 24.4 81.59% 29961.99 21735 40511 29978.36 26827 33913 730150 730150 0.00
crit 5.5 18.41% 60410.88 43470 81022 60282.72 0 81022 332187 332187 0.00
DPS Timeline Chart

Action details: felstorm

Static Values
  • id:89751
  • school:physical
  • resource:energy
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:60.0
  • cooldown:45.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:89751
  • name:Felstorm
  • school:physical
  • tooltip:Striking for $89753m1% weapon damage every $t1 sec. Unable to use abilities during Felstorm.
  • description:The Felguard recklessly swings its weapon, striking all nearby targets within $89753A1 yards for $89753m1% weapon damage every $89751t1 sec for $89751d. The Felguard cannot perform any other abilities during Felstorm.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:true
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_CLIP
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00

Action details: felstorm_tick

Static Values
  • id:89753
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:89753
  • name:Felstorm
  • school:physical
  • tooltip:(null)
  • description:$@spelldesc89751
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.50
legion_strike 7431 1.1% 20.5 20.49sec 30142 28984 25311 51479 30142 18.5% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: legion_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 20.51 20.51 0.00 0.00 1.0399 0.0000 618323.90 618323.90 0.00 28984.39 28984.39
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 16.73 81.54% 25310.71 18113 33759 25321.49 22197 28855 423357 423357 0.00
crit 3.79 18.46% 51479.09 36225 67519 50556.24 0 67519 194967 194967 0.00
DPS Timeline Chart

Action details: legion_strike

Static Values
  • id:30213
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:60.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:30213
  • name:Legion Strike
  • school:physical
  • tooltip:Effectiveness of any healing reduced by $w4%.
  • description:A sweeping attack that does $s2% of the Felguard's weapon damage divided among all targets within $A2 yards. The Felguard's current target is also wounded, reducing the effectiveness of any healing received by $s4% for $30213d.$?a104315[ Master gains $s3 Demonic Fury.][] |cFF777777(Right-Click to toggle)|r
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.25
melee 15868 2.4% 58.5 7.18sec 22570 16278 19969 40586 22570 18.4% 0.0% 23.9% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 58.54 58.54 0.00 0.00 1.3865 0.0000 1321361.05 1321361.05 0.00 16277.93 16277.93
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 33.78 57.70% 19968.79 14490 27007 19979.16 18212 22184 674578 674578 0.00
crit 10.75 18.36% 40585.74 28980 54015 40631.70 30035 52748 436155 436155 0.00
glance 14.02 23.94% 15027.20 10868 20256 15033.47 12384 18370 210629 210629 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00

Resources

Resource Usage Type Count Total Average RPE APR
Warlock_Demonology_T14H
corruption Mana 5.6 21042.8 3750.0 3750.0 244.1
dark_soul Mana 6.1 90816.0 15000.0 15000.0 0.0
doom Demonic Fury 8.7 523.4 60.0 60.0 12231.3
hand_of_guldan Mana 30.7 460204.5 15000.0 15000.0 6.3
shadow_bolt Mana 59.3 978167.8 16500.0 5500.0 3.9
soul_fire Mana 63.5 1429377.8 22500.2 17031.1 5.1
soul_fire Demonic Fury 20.4 1632.0 80.0 19.4 4430.6
summon_doomguard Mana 1.0 75000.0 75000.0 75000.0 15.7
touch_of_chaos Demonic Fury 127.2 5087.6 40.0 40.0 1366.6
pet - doomguard
doom_bolt Energy 21.3 745.9 35.0 35.0 1578.7
pet - felguard
felstorm Energy 10.3 618.2 60.0 60.0 3864.6
legion_strike Energy 87.3 5235.1 60.0 60.0 415.0
pet - wild_imp
firebolt Energy 338.4 338.4 1.0 1.0 15999.3
pet - service_felguard
felstorm Energy 4.3 258.2 60.0 60.0 4489.3
legion_strike Energy 20.5 1230.8 60.0 60.0 502.4
Resource Gains Type Count Total Average Overflow
felguard Demonic Fury 87.25 1047.02 12.00 0.00 0.00%
wild_imp Demonic Fury 338.43 1692.17 5.00 0.00 0.00%
service_felguard Demonic Fury 20.51 246.16 12.00 0.00 0.00%
corruption Demonic Fury 300.22 1200.86 4.00 0.00 0.00%
metamorphosis Demonic Fury 166.86 -997.53 -5.98 -3.60 0.36%
shadowflame Demonic Fury 270.18 540.37 2.00 0.00 0.00%
soul_fire Demonic Fury 63.53 1905.82 30.00 0.00 0.00%
life_tap Mana 13.70 1007170.29 73511.25 0.00 0.00%
shadow_bolt Demonic Fury 59.28 1482.07 25.00 0.00 0.00%
mp5_regen Mana 1797.26 1811447.66 1007.89 0.00 0.00%
pet - doomguard
energy_regen Energy 239.00 726.59 3.04 171.29 19.08%
pet - felguard
energy_regen Energy 1797.26 5750.63 3.20 0.00 0.00%
pet - service_felguard
energy_regen Energy 332.70 1048.55 3.15 50.79 4.62%
Resource RPS-Gain RPS-Loss
Health 0.00 2240.95
Mana 6271.42 6796.50
Demonic Fury 18.05 18.33
Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
blood_fury 4.3 0.0 120.9sec 120.8sec 14.05% 14.05%

Buff details

  • buff initial source:Warlock_Demonology_T14H
  • cooldown name:buff_blood_fury
  • max_stacks:1
  • duration:15.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:spell_power
    • amount:2257.20

    Stack Uptimes

    • blood_fury_1:14.1%

Spelldata details

  • id:33702
  • name:Blood Fury
  • tooltip:Spell power increased by $s2.
  • description:Increases your spell power by $s2. Lasts $d.
  • max_stacks:
  • duration:15.00
  • cooldown:120.00
  • default_chance:0.00%
bloodlust 1.0 0.0 0.0sec 0.0sec 9.04% 13.78%

Buff details

  • buff initial source:Warlock_Demonology_T14H
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • bloodlust_1:9.0%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell casting speed increased by $s1%.
  • description:Increases melee, ranged, and spell casting speed by $s1% for all party and raid members. Lasts $d. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for $57724d.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
dark_soul 6.1 0.0 80.8sec 80.8sec 26.36% 30.41%

Buff details

  • buff initial source:Warlock_Demonology_T14H
  • cooldown name:buff_dark_soul
  • max_stacks:1
  • duration:20.00
  • cooldown:80.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • dark_soul_1:26.4%

Spelldata details

  • id:113861
  • name:Dark Soul: Knowledge
  • tooltip:Mastery increased by $s1.
  • description:Your soul is infused with demonic knowledge, increasing your Mastery by ${$113861m1} for $113861d.$?s56228[ |cFFFFFFFFPassive:|r Increases your Mastery by ${$113861m1/$56228m1}. This effect is disabled while on cooldown.][]
  • max_stacks:
  • duration:20.00
  • cooldown:120.00
  • default_chance:0.00%
demonic_calling 1.0 0.2 0.0sec 0.0sec 1.26% 0.37%

Buff details

  • buff initial source:Warlock_Demonology_T14H
  • cooldown name:buff_demonic_calling
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • demonic_calling_1:1.3%

Spelldata details

  • id:114925
  • name:Demonic Calling
  • tooltip:Your next Shadow Bolt, Soul Fire,$?s114168[ Demonic Slash,][] or Touch of Chaos will summon a Wild Imp to attack the target.
  • description:Your next Shadow Bolt, Soul Fire,$?s114168[ Demonic Slash,][] or Touch of Chaos will summon a Wild Imp to attack the target.
  • max_stacks:1
  • duration:-0.00
  • cooldown:0.00
  • default_chance:1.00%
essence_of_terror 7.5 0.0 62.8sec 62.8sec 32.90% 32.90%

Buff details

  • buff initial source:Warlock_Demonology_T14H
  • cooldown name:buff_essence_of_terror
  • max_stacks:1
  • duration:20.00
  • cooldown:60.00
  • default_chance:15.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:haste_rating
    • amount:7796.00

    Stack Uptimes

    • essence_of_terror_1:32.9%
jade_serpent_potion 2.0 0.0 360.9sec 0.0sec 10.18% 10.18%

Buff details

  • buff initial source:Warlock_Demonology_T14H
  • cooldown name:buff_jade_serpent_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:intellect
    • amount:4000.00

    Stack Uptimes

    • jade_serpent_potion_1:10.2%
jade_spirit 8.7 0.0 53.9sec 53.9sec 22.89% 23.31%

Buff details

  • buff initial source:Warlock_Demonology_T14H
  • cooldown name:buff_jade_spirit
  • max_stacks:1
  • duration:12.00
  • cooldown:50.00
  • default_chance:10.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:intellect
    • amount:1650.00
    • stat:spirit
    • amount:750.00

    Stack Uptimes

    • jade_spirit_1:22.9%
metamorphosis 29.5 0.0 15.5sec 15.5sec 38.99% 63.23%

Buff details

  • buff initial source:Warlock_Demonology_T14H
  • cooldown name:buff_metamorphosis
  • max_stacks:1
  • duration:0.00
  • cooldown:10.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • metamorphosis_1:39.0%

Spelldata details

  • id:103958
  • name:Metamorphosis
  • tooltip:Demon Form. Damage dealt increased by $103958w2%.
  • description:Temporarily transform into a demon, increasing damage dealt by ${$104315m1*$m3/100+$77219m1*$m3/100}.2%. $?!s124917|!s124913[ Metamorphosis prevents the use of ][]$?!s124913[Corruption and ][]$?!s124917[Hand of Gul'dan.][]
  • max_stacks:
  • duration:-0.00
  • cooldown:10.00
  • default_chance:1.00%
molten_core 18.9 70.0 18.7sec 5.0sec 52.03% 100.00%

Buff details

  • buff initial source:Warlock_Demonology_T14H
  • cooldown name:buff_molten_core
  • max_stacks:99
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • molten_core_1:18.9%
  • molten_core_2:8.5%
  • molten_core_3:4.8%
  • molten_core_4:3.4%
  • molten_core_5:2.8%
  • molten_core_6:2.5%
  • molten_core_7:2.3%
  • molten_core_8:2.1%
  • molten_core_9:1.8%
  • molten_core_10:1.4%
  • molten_core_11:1.1%
  • molten_core_12:0.8%
  • molten_core_13:0.6%
  • molten_core_14:0.4%
  • molten_core_15:0.3%
  • molten_core_16:0.2%
  • molten_core_17:0.1%
  • molten_core_18:0.1%
  • molten_core_19:0.0%
  • molten_core_20:0.0%
  • molten_core_21:0.0%
  • molten_core_22:0.0%
  • molten_core_23:0.0%
  • molten_core_24:0.0%
  • molten_core_25:0.0%
  • molten_core_26:0.0%
  • molten_core_27:0.0%
  • molten_core_28:0.0%

Spelldata details

  • id:122355
  • name:Molten Core
  • tooltip:The cast time and mana cost of Soul Fire is reduced by $w1%.$?($W3>0)[ Soul Fire grants $s3 additional Demonic Fury.][]
  • description:Reduces the cast time and mana cost of your next Soul Fire spell by $122355s1%. $?($m3>0)[Soul Fire grants $s3 additional Demonic Fury. ][] Lasts $d.
  • max_stacks:
  • duration:30.00
  • cooldown:0.00
  • default_chance:1.00%
relic_of_yulon 9.0 0.0 52.1sec 52.1sec 29.63% 29.63%

Buff details

  • buff initial source:Warlock_Demonology_T14H
  • cooldown name:buff_relic_of_yulon
  • max_stacks:1
  • duration:15.00
  • cooldown:50.00
  • default_chance:20.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:intellect
    • amount:3027.00

    Stack Uptimes

    • relic_of_yulon_1:29.6%
synapse_springs_2 7.9 0.0 60.9sec 60.9sec 17.33% 17.33%

Buff details

  • buff initial source:Warlock_Demonology_T14H
  • cooldown name:synapse_springs_2_hands
  • max_stacks:1
  • duration:10.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:intellect
    • amount:2940.00

    Stack Uptimes

    • synapse_springs_2_1:17.3%
Constant Buffs
attack_haste

Buff details

  • buff initial source:
  • cooldown name:buff_attack_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_haste_1:100.0%
attack_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.0%
critical_strike

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.0%
mastery

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.0%
spell_haste

Buff details

  • buff initial source:
  • cooldown name:buff_spell_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • spell_haste_1:100.0%
spell_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.0%
stamina

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.0%
str_agi_int

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.0%

Benefits & Uptimes

Benefits %%
Uptimes %%

Procs

Count Interval
wild_imp 8.4 52.0sec

Statistics & Data Analysis

Fight Length

Sample Data
Count 10000
Mean 449.44
Minimum 340.40
Maximum 563.02
Spread ( max - min ) 222.62
Range [ ( max - min ) / 2 * 100% ] 24.77%

DPS

Sample Data
Count 10000
Mean 122061.76
Minimum 113245.55
Maximum 133369.19
Spread ( max - min ) 20123.64
Range [ ( max - min ) / 2 * 100% ] 8.24%
Standard Deviation 2824.6984
5th Percentile 117683.23
95th Percentile 126957.69
( 95th Percentile - 5th Percentile ) 9274.46
Mean Distribution
Standard Deviation 28.2470
95.00% Confidence Intervall ( nan - nan )
Normalized 95.00% Confidence Intervall ( nan% - nan% )
Approx. Iterations needed for ( always use n>=50 )
1% Error -2147483648
0.1% Error -2147483648
0.1 Scale Factor Error with Delta=300 -2147483648
0.05 Scale Factor Error with Delta=300 -2147483648
0.01 Scale Factor Error with Delta=300 -2147483648
Distribution Chart

DPS(e)

Sample Data
Count 10000
Mean 122061.76

Damage

Sample Data
Count 10000
Mean 34578802.15

DTPS

Sample Data
Count 10000
Mean 0.00

HPS

Sample Data
Count 10000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( nan - nan )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 -2147483648
0.05 Scale Factor Error with Delta=300 -2147483648
0.01 Scale Factor Error with Delta=300 -2147483648
Distribution Chart

HPS(e)

Sample Data
Count 10000
Mean 0.00

Heal

Sample Data
Count 10000
Mean 0.00

HTPS

Sample Data
Count 10000
Mean 0.00

#Executed Foreground Actions

Sample Data
Count 10000
Mean 439.61
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat
# action,conditions
0 flask,type=warm_sun
1 food,type=mogu_fish_stew
2 dark_intent,if=!aura.spell_power_multiplier.up
3 summon_felguard
4 snapshot_stats
5 jade_serpent_potion
Default action list
# action,conditions
6 curse_of_the_elements,if=debuff.magic_vulnerability.down
7 use_item,name=shaskin_gloves
8 jade_serpent_potion,if=buff.bloodlust.react|target.health.pct<=20
9 blood_fury
A dark_soul
B service_felguard,if=talent.grimoire_of_service.enabled
C grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
D summon_felguard,if=talent.grimoire_of_sacrifice.enabled&buff.grimoire_of_sacrifice.down
E melee
F felguard:felstorm
G run_action_list,name=aoe,if=num_targets>5
H summon_doomguard
I corruption,cycle_targets=1,if=(!ticking|remains<tick_time)&target.time_to_die>=6&miss_react
J doom,cycle_targets=1,if=(!ticking|remains<tick_time|(ticks_remain+1<n_ticks&buff.dark_soul.up))&target.time_to_die>=30&miss_react
K metamorphosis,if=buff.dark_soul.up|dot.corruption.remains<5|demonic_fury>=900|demonic_fury>=target.time_to_die*30
L cancel_metamorphosis,if=dot.corruption.remains>15&buff.dark_soul.down&demonic_fury<=750&target.time_to_die>30
M imp_swarm
N hand_of_guldan,if=!in_flight&dot.shadowflame.remains<travel_time+action.shadow_bolt.cast_time
O soul_fire,if=buff.molten_core.react&(buff.metamorphosis.down|target.health.pct<25)
P touch_of_chaos
Q life_tap,if=mana.pct<50
R shadow_bolt
S fel_flame,moving=1
T life_tap

Sample Sequence

79ABFHIKEJJMPJPNORRKEPPPPPPPPPLNOOONOOOOOKEPPPPPPPPLNOFOOOOQQKEPPPPPLN7RRRRRNKEPPPPPPPLRARKEJPPPPPPPNFRKEPPOONOMQRRKEPPPPPLRNOR9BO7QOKEPPPPPPPLNOOOFOROOKEPPPPPLNQRRROKEJPAPPPPPPPPPPPNRKEPNRRR7FQRKEPPPPPNORRMORKEPPPPPPPLNOOOOONQKEPPPPPLRRFRRNRKEJPP9ABPPP7PPPPPNRKEPPRRQRRNRKEPPPPPRRFRRNKEPPMPPPRRRONKEPPPPPLRQ7RRNRRKEJPPPPPPFLOARKEPPJNRRQRKEPPPNRROOKEOOPOIONOOO8O9BOO7OFMKEOOOOOOOINOONQOOOOKEOOOOOPIANOKEPOQOOFONOKEJOOIOQO7ONOOOQOKEOOOOPNOKEPO

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 158 150 80
Agility 162 154 80
Stamina 24548 22317 20183
Intellect 21165 18792 17713
Spirit 550 550 350
Health 490075 458841 0
Mana 300000 300000 0
Demonic Fury 1000 1000 0
Spell Power 31968 26689 7907
Spell Hit 15.01% 15.01% 5105
Spell Crit 19.45% 13.51% 2636
Spell Haste 24.48% 18.55% 7883
Mana Per 5 18671 17782 0
Attack Power 315 270 0
Melee Hit 15.01% 15.01% 5105
Melee Crit 12.22% 7.21% 2636
Melee Haste 18.55% 18.55% 7883
Swing Speed 30.40% 18.55% 7883
Expertise 0.00% 0.00% 0
Armor 14947 14947 14857
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 0.00% 0.00% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 17.95% 12.95% 2972

Talents

Level
15 Dark Regeneration Soul Leech Harvest Life
30 Howl of Terror Mortal Coil Shadowfury
45 Soul Link Sacrificial Pact Dark Bargain
60 Blood Fear Burning Rush Unbound Will
75 Grimoire of Supremacy Grimoire of Service Grimoire of Sacrifice
90 Archimonde's Vengeance Kil'jaeden's Cunning Mannoroth's Fury

Profile

#!./simc

warlock="Warlock_Demonology_T14H"
origin="unknown"
level=90
race=orc
spec=demonology
role=spell
position=back
professions=engineering=600/enchanting=600
talents=http://us.battle.net/wow/en/game/mists-of-pandaria/feature/talent-specification#VZ!2...1.
glyphs=imp_swarm/shadow_bolt
actions.precombat=flask,type=warm_sun
actions.precombat+=/food,type=mogu_fish_stew
actions.precombat+=/dark_intent,if=!aura.spell_power_multiplier.up
actions.precombat+=/summon_felguard
actions.precombat+=/snapshot_stats
actions.precombat+=/jade_serpent_potion
actions=curse_of_the_elements,if=debuff.magic_vulnerability.down
actions+=/use_item,name=shaskin_gloves
actions+=/jade_serpent_potion,if=buff.bloodlust.react|target.health.pct<=20
actions+=/blood_fury
actions+=/dark_soul
actions+=/service_felguard,if=talent.grimoire_of_service.enabled
actions+=/grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
actions+=/summon_felguard,if=talent.grimoire_of_sacrifice.enabled&buff.grimoire_of_sacrifice.down
actions+=/melee
actions+=/felguard:felstorm
actions+=/run_action_list,name=aoe,if=num_targets>5
actions+=/summon_doomguard
actions+=/corruption,cycle_targets=1,if=(!ticking|remains=6&miss_react
actions+=/doom,cycle_targets=1,if=(!ticking|remains=30&miss_react
actions+=/metamorphosis,if=buff.dark_soul.up|dot.corruption.remains<5|demonic_fury>=900|demonic_fury>=target.time_to_die*30
actions+=/cancel_metamorphosis,if=dot.corruption.remains>15&buff.dark_soul.down&demonic_fury<=750&target.time_to_die>30
actions+=/imp_swarm
actions+=/hand_of_guldan,if=!in_flight&dot.shadowflame.remains actions+=/soul_fire,if=buff.molten_core.react&(buff.metamorphosis.down|target.health.pct<25)
actions+=/touch_of_chaos
actions+=/life_tap,if=mana.pct<50
actions+=/shadow_bolt
actions+=/fel_flame,moving=1
actions+=/life_tap
actions.aoe=summon_doomguard,if=num_targets<7
actions.aoe+=/summon_infernal,if=num_targets>=7
actions.aoe+=/imp_swarm,if=buff.metamorphosis.down
actions.aoe+=/corruption,cycle_targets=1,if=(!ticking|remains=6&miss_react
actions.aoe+=/hand_of_guldan
actions.aoe+=/metamorphosis,if=demonic_fury>=1000|demonic_fury>=31*target.time_to_die
actions.aoe+=/immolation_aura
actions.aoe+=/void_ray,if=dot.corruption.remains<10
actions.aoe+=/doom,cycle_targets=1,if=(!ticking|remains<40)&target.time_to_die>30&miss_react
actions.aoe+=/void_ray
actions.aoe+=/harvest_life,chain=1,if=talent.harvest_life.enabled
actions.aoe+=/hellfire,if=!talent.harvest_life.enabled
actions.aoe+=/life_tap
head=shaskin_hood,id=87188,gems=burning_primal_80int_160hit_180int,reforge=crit_haste
neck=amulet_of_seven_curses,id=87028,reforge=crit_haste
shoulders=shaskin_mantle,id=87191,gems=80int_160hit_60int,enchant=200int_100crit,reforge=mastery_haste
chest=shaskin_robes,id=87190,gems=80int_160haste_80int_160haste_180haste,enchant=80all,reforge=crit_mastery
waist=belt_of_malleable_amber,id=86981,gems=80int_160haste_80int_160hit_160int_120haste
legs=dreadwoven_leggings_of_failure,id=87174,gems=160int_80int_160hit_120int,enchant=285int_165crit
feet=sandals_of_the_blackest_night,id=87162,gems=80int_160haste_60mastery,enchant=140mastery
wrists=twisting_wind_bracers,id=86958,enchant=170int
hands=shaskin_gloves,id=87187,enchant=170haste,addon=synapse_springs_mark_ii
finger1=watersoul_signet,id=87151,enchant=160int,reforge=spi_mastery
finger2=fragment_of_fear_made_flesh,id=86949,enchant=160int,reforge=hit_haste
trinket1=essence_of_terror,id=87175
trinket2=relic_of_yulon,id=79331
back=cloak_of_overwhelming_corruption,id=87150,enchant=180int,reforge=mastery_hit
main_hand=loshan_terror_incarnate,id=87164,enchant=jade_spirit,reforge=crit_mastery
off_hand=tornadosummoning_censer,id=86960,enchant=165int,reforge=crit_haste
# Gear Summary
# gear_strength=80
# gear_agility=80
# gear_stamina=20183
# gear_intellect=17713
# gear_spirit=350
# gear_spell_power=7907
# gear_hit_rating=5105
# gear_crit_rating=2636
# gear_haste_rating=7883
# gear_mastery_rating=2972
# gear_armor=14857
# meta_gem=burning_primal
# tier14_2pc_caster=1
# tier14_4pc_caster=1
# hands=shaskin_gloves,heroic=1,addon=synapse_springs_mark_ii
# main_hand=loshan_terror_incarnate,heroic=1,weapon=sword_2.20speed_2880min_5349max,enchant=jade_spirit

Warlock_Demonology_T14H_GoSac : 123488 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active
123487.7 123487.7 nan / nan% 5290 / 4.3% 14.2 7185.7 6658.2 Mana 0.00% 55.6 100.0%
Talents http://us.battle.net/wow/en/game/mists-of-pandaria/feature/talent-specification#VZ!2...2.
Glyphs
  • imp_swarm
  • shadow_bolt

Charts

http://1.chart.apis.google.com/chart?chs=550x240&cht=bhg&chf=bg,s,333333&chd=t:948599|713072|93526|85814|80018|62843|17696&chds=0,1897198&chco=C79C6E,9482C9,435133,C41F3B,FF6F00,9482C9,9482C9&chm=t++948599++summon_doomguard,C79C6E,0,0,15|t++713072++doom,9482C9,1,0,15|t++93526++hand_of_guldan,435133,2,0,15|t++85814++soul_fire,C41F3B,3,0,15|t++80018++touch_of_chaos,FF6F00,4,0,15|t++62843++shadow_bolt,9482C9,5,0,15|t++17696++melee,9482C9,6,0,15&chtt=Warlock_Demonology_T14H_GoSac Damage Per Execute Time&&chts=dddddd,18 http://2.chart.apis.google.com/chart?chs=550x275&cht=p&chf=bg,s,333333&chd=t:24,20,18,17,14,11,6,4,3,3,0&chds=0,100&chdls=ffffff&chco=C41F3B,FF6F00,C41F3B,9482C9,9482C9,9482C9,9482C9,435133,435133,9482C9,C79C6E&chl=soul_fire|touch_of_chaos|wild_imp: firebolt|shadow_bolt|doom|corruption|melee|shadowflame|hand_of_guldan|doomguard: doom_bolt|felguard: legion_strike&chtt=Warlock_Demonology_T14H_GoSac Damage Sources&chts=dddddd,18
http://4.chart.apis.google.com/chart?chs=525x185&cht=lc&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chg=100,20&chd=s:ZZglruwxz003667877776551xtpnmjgecaaabbbaaZYYZZYYXVVVXXXXXVVWYYYXXVVVWWWXXWWWXWWWWUUVVWWXXWWWWVVVVWXXYYYYYYYZZZaaabccccccbbaaZZYYYXWWVVUUTTTTSSSSRRRRRRRRRSTTTTTTTTUUVWWWWWVVWXWWVVVVVUTTTTTTTTTTTSSTUUVVWWXYYYYYZabbbbaaZYYXXXWVVUUTSRQQRRSSTTTUUUUUVVWWWWWWXWWVVVVUUUTTTTSSTTTTTTSSSSSSTTUUVVVWWWWWXYZZZaaaZZYYYYYXXXXWWVVVWWWXXXXYYYYYZZaaaaaaZZYYXXXWWWVVUUTTTTTSSSSSTTTTTTTUUUUUVVVWWWXXYYZZaaabbccdddddddddddddcccbbbaaaaaaaZZZYXXWWWWWWWVVVUUUTTUUUUUUUTTTTTUTTTTTTTTTTTUUUVVVVVVVWWXYYZabcddeeffghhiiiihhggffeccbaZYXXWVVUUUUTTTTTTTUUUUUUUTTTTTUUUUUUTTTTTTTUUUUTTTTTTTTTTT&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=563|1:|0|avg=123488|max=302983&chxp=1,1,41,100&chtt=Warlock_Demonology_T14H_GoSac DPS Timeline&chts=dddddd,18 http://7.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chxs=0,ffffff|1,ffffff&chd=t:1,2,1,5,3,14,20,51,58,84,138,190,196,327,373,420,548,555,605,615,662,667,618,592,488,468,469,346,286,246,224,167,131,109,91,61,45,26,24,21,15,10,12,4,6,1,3,1,0,1&chds=0,667&chbh=5&chxt=x&chxl=0:|min=112498|avg=123488|max=138033&chxp=0,1,43,100&chtt=Warlock_Demonology_T14H_GoSac DPS Distribution&chts=dddddd,18 http://3.chart.apis.google.com/chart?chs=525x275&cht=p&chf=bg,s,333333&chd=t:28.7,28.2,25.2,8.0,4.2,2.1,2.0,1.2,0.3&chds=0,100&chdls=ffffff&chco=C41F3B,9482C9,FF6F00,435133,9482C9,9482C9,9482C9,C79C6E,C79C6E&chl=soul_fire 129.0s|shadow_bolt 126.8s|touch_of_chaos 113.3s|hand_of_guldan 36.0s|life_tap 19.0s|corruption 9.3s|doom 9.0s|imp_swarm 5.5s|summon_doomguard 1.2s&chtt=Warlock_Demonology_T14H_GoSac Spent Time&chts=dddddd,18

Abilities

Damage Stats DPS DPS%% Count Interval DPE DPET Hit Crit Avg Crit%% Avoid%% G%% B%% Ticks T-Hit T-Crit T-Avg T-Crit%% T-Avoid%% Up%%
Warlock_Demonology_T14H_GoSac 123488
blood_fury 0 0.0% 4.3 120.89sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: blood_fury

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 4.30 4.30 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
none 4.30 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: blood_fury

Static Values
  • id:33702
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:33702
  • name:Blood Fury
  • school:physical
  • tooltip:Spell power increased by $s2.
  • description:Increases your spell power by $s2. Lasts $d.
cancel_metamorphosis 0 0.0% 6.8 40.05sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: cancel_metamorphosis

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 6.81 6.81 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
none 6.81 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: cancel_metamorphosis

Static Values
  • id:0
  • school:unknown
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:dot.corruption.remains>15&buff.dark_soul.down&demonic_fury<=750&target.time_to_die>30
corruption 11112 9.0% 7.8 63.02sec 635920 535514 0 0 0 0.0% 0.0% 0.0% 0.0% 295.2 14228 29657 16910 17.4% 0.0% 97.4%

Stats details: corruption

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 7.85 7.85 295.18 295.18 1.1875 1.4837 4991529.64 4991529.64 0.00 11159.99 535514.39
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 7.85 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 243.9 82.61% 14227.76 9002 27945 14231.55 13321 15203 3469544 3469544 0.00
crit 51.3 17.39% 29657.41 18544 57567 29666.99 25093 35013 1521986 1521986 0.00
DPS Timeline Chart

Action details: corruption

Static Values
  • id:172
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3750.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(!ticking|remains=6&miss_react
Spelldata
  • id:172
  • name:Corruption
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $?$W2=2[${$t1/2000}.2][$t1] sec.
  • description:Corrupts the target, causing $o3 Shadow damage over $d.$?a104315[ Generates 4 Demonic Fury each time it deals damage.][]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.200000
  • base_td:213.64
  • num_ticks:9
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_EXTEND
dark_soul 0 0.0% 6.1 80.87sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: dark_soul

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 6.05 6.05 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
none 6.05 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: dark_soul

Static Values
  • id:113861
  • school:shadow
  • resource:mana
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:15000.0
  • cooldown:80.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:113861
  • name:Dark Soul: Knowledge
  • school:shadow
  • tooltip:Mastery increased by $s1.
  • description:Your soul is infused with demonic knowledge, increasing your Mastery by ${$113861m1} for $113861d.$?s56228[ |cFFFFFFFFPassive:|r Increases your Mastery by ${$113861m1/$56228m1}. This effect is disabled while on cooldown.][]
doom 14374 11.6% 8.7 49.65sec 738827 713072 0 0 0 0.0% 0.0% 0.0% 0.0% 41.7 129211 270503 154550 17.9% 0.0% 98.2%

Stats details: doom

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 8.73 8.73 41.72 41.72 1.0361 10.5767 6447593.48 6447593.48 0.00 14318.95 713071.61
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 8.73 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 34.2 82.07% 129211.47 74714 177826 129287.96 105244 148049 4423774 4423774 0.00
crit 7.5 17.93% 270502.57 153911 366321 270706.46 153911 366321 2023819 2023819 0.00
DPS Timeline Chart

Action details: doom

Static Values
  • id:603
  • school:shadow
  • resource:demonic_fury
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:60.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(!ticking|remains=30&miss_react
Spelldata
  • id:603
  • name:Doom
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $?$W2=2[${$t1/2000}.2][$t1] sec.
  • description:Inflicts impending doom upon the target, causing ${($m1+$SP*1)*4} Shadow damage over $d. When Doom critically strikes, a Wild Imp will be summoned to attack the target.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:1.400000
  • base_td:1495.48
  • num_ticks:4
  • base_tick_time:15.00
  • hasted_ticks:true
  • dot_behavior:DOT_EXTEND
hand_of_guldan 7504 6.1% 30.8 14.58sec 109310 93526 18558 38688 22080 17.5% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: hand_of_guldan

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 30.81 61.37 0.00 0.00 1.1688 0.0000 1355043.28 1355043.28 0.00 93525.53 93525.53
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 50.63 82.50% 18558.50 0 59726 18562.52 12538 24104 939639 939639 0.00
crit 10.74 17.50% 38687.61 0 123035 38721.60 0 89969 415404 415404 0.00
DPS Timeline Chart

Action details: hand_of_guldan

Static Values
  • id:105174
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:1.3000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:15000.0
  • cooldown:15.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!in_flight&dot.shadowflame.remains
Spelldata
  • id:105174
  • name:Hand of Gul'dan
  • school:shadow
  • tooltip:(null)
  • description:Summons a falling meteor to strike the target and all enemies within $86040A1 yards for $86040s1 Shadow damage and inflicting them with Shadowflame. $@spellicon47960 $@spellname47960 $@spelldesc47960
imp_swarm 0 0.0% 5.3 93.78sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: imp_swarm

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 5.26 5.26 0.00 0.00 1.0361 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
none 5.26 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: imp_swarm

Static Values
  • id:104316
  • school:physical
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:83.49
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:104316
  • name:Imp Swarm
  • school:physical
  • tooltip:(null)
  • description:Summons $104316s1 $104316lWild Imp:Wild Imps; from the Twisting Nether to attack the target. The Wild Imps passive effect is disabled while Imp Swarm is on cooldown. Imp Swarm's cooldown is reduced by spell haste. Also increases Wild Imp's cooldown by $s3 sec.
life_tap 0 0.0% 16.1 26.47sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: life_tap

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 16.07 16.07 0.00 0.00 1.1797 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
none 16.07 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: life_tap

Static Values
  • id:1454
  • school:shadow
  • resource:health
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:mana.pct<50
Spelldata
  • id:1454
  • name:Life Tap
  • school:shadow
  • tooltip:Absorbs $w3 healing.
  • description:$?s63320[Places a stacking heal absorb effect on you for $d equal to $m3% of your total health and restores][Restores] ${$m1*$MHP*0.01} mana.$?s63320[ Lasts $d.][]
melee 6488 5.3% 223.6 2.00sec 13025 17696 10982 22999 13089 17.5% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 223.59 222.49 0.00 0.00 0.7360 0.0000 2912210.52 2912210.52 0.00 17696.31 17696.31
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 183.48 82.46% 10981.69 8272 19689 10984.33 10212 11830 2014883 2014883 0.00
crit 39.02 17.54% 22999.49 17041 40559 23007.04 19084 28000 897327 897327 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:103988
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:103988
  • name:Melee
  • school:shadow
  • tooltip:(null)
  • description:Your melee attacks become long ranged and deal Shadow.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.100000
  • base_dd_min:101.48
  • base_dd_max:112.16
metamorphosis 0 0.0% 29.8 15.34sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: metamorphosis

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 29.76 29.76 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
none 29.76 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: metamorphosis

Static Values
  • id:103958
  • school:physical
  • resource:demonic_fury
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:10.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:103958
  • name:Metamorphosis
  • school:physical
  • tooltip:Demon Form. Damage dealt increased by $103958w2%.
  • description:Temporarily transform into a demon, increasing damage dealt by ${$104315m1*$m3/100+$77219m1*$m3/100}.2%. $?!s124917|!s124913[ Metamorphosis prevents the use of ][]$?!s124913[Corruption and ][]$?!s124917[Hand of Gul'dan.][]
shadow_bolt 17734 14.4% 199.4 5.11sec 39978 62843 33724 70040 39978 17.2% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 199.39 199.39 0.00 0.00 0.6362 0.0000 7971090.92 7971090.92 0.00 62843.17 62843.17
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 165.05 82.78% 33723.87 25051 73062 33744.17 31867 36408 5566145 5566145 0.00
crit 34.34 17.22% 70040.32 51606 150508 70087.69 58660 86107 2404946 2404946 0.00
DPS Timeline Chart

Action details: shadow_bolt

Static Values
  • id:686
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:16500.0
  • cooldown:0.00
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:686
  • name:Shadow Bolt
  • school:shadow
  • tooltip:(null)
  • description:Sends a shadowy bolt at the enemy, causing $s3 Shadow damage.$?a104315[ Generates 25 Demonic Fury.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:1.163000
  • base_dd_min:1242.32
  • base_dd_max:1242.32
shadowflame 4487 3.6% 30.7 14.58sec 65621 0 0 0 0 17.6% 0.0% 0.0% 0.0% 243.1 6968 14511 8282 17.4% 0.0% 39.5%

Stats details: shadowflame

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 30.68 30.68 243.06 243.06 0.0000 0.7296 2013091.61 2013091.61 0.00 11351.72 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 25.29 82.44% 0.00 0 0 0.00 0 0 0 0 0.00
crit 5.39 17.56% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 200.7 82.57% 6967.73 5605 19597 6972.87 6437 8330 1398373 1398373 0.00
crit 42.4 17.43% 14510.96 11546 40370 14524.65 12747 19863 614719 614719 0.00
DPS Timeline Chart

Action details: shadowflame

Static Values
  • id:47960
  • school:shadowflame
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:47960
  • name:Shadowflame
  • school:shadowflame
  • tooltip:Deals $w1 Shadowflame damage every $t1 sec. Movement speed reduced by $w2%.
  • description:Reduces movement speed by $47960s2% and deals $47960o1 Shadowflame damage over $47960d. Generates 2 Demonic Fury every time it deals damage.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.137000
  • base_td:146.34
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
soul_fire 24654 20.0% 83.8 5.20sec 132077 85814 0 133282 133282 100.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: soul_fire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 83.80 83.04 0.00 0.00 1.5391 0.0000 11067811.90 11067811.90 0.00 85814.29 85814.29
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
crit 83.04 100.00% 133281.94 106581 306808 133356.74 125528 144556 11067812 11067812 0.00
DPS Timeline Chart

Action details: soul_fire

Static Values
  • id:6353
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:24.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:45000.0
  • cooldown:0.00
  • base_execute_time:4.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.molten_core.react&(buff.metamorphosis.down|target.health.pct<25)
Spelldata
  • id:6353
  • name:Soul Fire
  • school:fire
  • tooltip:(null)
  • description:Burn the enemy's soul, causing $s1 Fire damage.$?s108869&1=0[ If used on a target below 25% health, the attack will trigger Molten Core.][] Soul Fire always critically strikes. In addition, the damage is increased by your critical strike chance.$?a104315&!a54879[ Generates 30 Demonic Fury.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:0.683000
  • base_dd_min:656.62
  • base_dd_max:802.54
summon_doomguard 2662 2.1% 1.0 nansec 1177211 948599 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: summon_doomguard

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 1.00 2.00 0.00 0.00 1.2410 0.0000 0.00 0.00 0.00 948599.07 948599.07
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
none 2.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: summon_doomguard

Static Values
  • id:18540
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:75000.0
  • cooldown:600.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:18540
  • name:Summon Doomguard
  • school:shadow
  • tooltip:(null)
  • description:Summons a Doomguard to attack the target for $60478d. Doomguard will cast Doom Bolt until it departs. $@spelltooltip85692
touch_of_chaos 20172 16.4% 109.3 3.94sec 82919 80018 69631 145586 82938 17.5% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: touch_of_chaos

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 109.32 109.29 0.00 0.00 1.0362 0.0000 9064695.01 9064695.01 0.00 80018.14 80018.14
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 90.15 82.48% 69630.82 53577 127518 69654.34 63122 77794 6276947 6276947 0.00
crit 19.15 17.52% 145586.47 110369 262687 145739.46 114404 204024 2787748 2787748 0.00
DPS Timeline Chart

Action details: touch_of_chaos

Static Values
  • id:103964
  • school:chaos
  • resource:demonic_fury
  • range:40.0
  • travel_speed:120.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:40.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:103964
  • name:Touch of Chaos
  • school:chaos
  • tooltip:(null)
  • description:Unleashes energy at the enemy, causing $s1 Chaos damage and extending the duration of Corruption.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.635000
  • base_dd_min:644.39
  • base_dd_max:712.22
pet - doomguard 19620 / 2662
doom_bolt 19620 2.1% 21.3 2.76sec 55251 19895 46491 96152 55251 17.6% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: doom_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 21.31 21.31 0.00 0.00 2.7771 0.0000 1177211.44 1177211.44 0.00 19895.07 19895.07
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 17.55 82.36% 46491.47 37536 70716 46479.94 39848 51982 815842 815842 0.00
crit 3.76 17.64% 96152.47 75072 141432 94779.55 0 141432 361370 361370 0.00
DPS Timeline Chart

Action details: doom_bolt

Static Values
  • id:85692
  • school:shadow
  • resource:energy
  • range:30.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:35.0
  • cooldown:0.00
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:85692
  • name:Doom Bolt
  • school:shadow
  • tooltip:(null)
  • description:Sends a shadowy bolt at the enemy, causing $s1 Shadow damage. Deals $s2% additional damage to targets below 20% health.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.900000
  • base_dd_min:913.31
  • base_dd_max:1009.45
pet - felguard 0 / 61
legion_strike 0 0.0% 1.0 nansec 27054 26114 22582 45165 27054 19.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% nan%

Stats details: legion_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 1.00 1.00 0.00 0.00 1.0360 0.0000 27053.70 27053.70 0.00 26113.61 26113.61
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 0.80 80.20% 22582.39 22582 22582 18111.08 0 22582 18111 18111 0.00
crit 0.20 19.80% 45164.78 45165 45165 8942.63 0 45165 8943 8943 0.00
DPS Timeline Chart

Action details: legion_strike

Static Values
  • id:30213
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:60.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:30213
  • name:Legion Strike
  • school:physical
  • tooltip:Effectiveness of any healing reduced by $w4%.
  • description:A sweeping attack that does $s2% of the Felguard's weapon damage divided among all targets within $A2 yards. The Felguard's current target is also wounded, reducing the effectiveness of any healing received by $s4% for $30213d.$?a104315[ Master gains $s3 Demonic Fury.][] |cFF777777(Right-Click to toggle)|r
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.25
pet - wild_imp 46639 / 18727
firebolt 46639 15.2% 338.9 1.38sec 24792 12162 23335 47616 27641 17.7% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: firebolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 338.89 303.95 0.00 0.00 2.0384 0.0000 8401503.10 8401503.10 0.00 12162.33 12162.33
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 250.04 82.26% 23334.58 19393 36536 23367.14 22061 25310 5834525 5834525 0.00
crit 53.91 17.74% 47616.34 38786 73072 47683.86 41352 54805 2566978 2566978 0.00
DPS Timeline Chart

Action details: firebolt

Static Values
  • id:104318
  • school:fire
  • resource:energy
  • range:40.0
  • travel_speed:16.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:104318
  • name:Firebolt
  • school:fire
  • tooltip:(null)
  • description:Deals $s1 Fire damage to a target.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.300000
  • base_dd_min:312.45
  • base_dd_max:328.47

Resources

Resource Usage Type Count Total Average RPE APR
Warlock_Demonology_T14H_GoSac
corruption Mana 7.8 29434.9 3750.0 3750.0 169.6
dark_soul Mana 6.1 90784.5 15000.0 15000.0 0.0
doom Demonic Fury 8.7 523.6 60.0 60.0 12313.8
hand_of_guldan Mana 30.8 462189.0 15000.0 15000.0 7.3
shadow_bolt Mana 66.5 1096629.6 16500.0 5500.0 7.3
soul_fire Mana 65.6 1475507.2 22500.0 17607.9 7.5
soul_fire Demonic Fury 18.2 1457.6 80.0 17.4 7593.1
summon_doomguard Mana 1.0 75000.0 75000.0 75000.0 15.7
touch_of_chaos Demonic Fury 109.3 4372.8 40.0 40.0 2073.0
pet - doomguard
doom_bolt Energy 21.3 745.7 35.0 35.0 1578.6
pet - felguard
legion_strike Energy 1.0 60.0 60.0 60.0 450.9
pet - wild_imp
firebolt Energy 338.9 338.9 1.0 1.0 24791.6
Resource Gains Type Count Total Average Overflow
felguard Demonic Fury 1.00 12.00 12.00 0.00 0.00%
wild_imp Demonic Fury 338.89 1694.43 5.00 0.00 0.00%
corruption Demonic Fury 303.03 1212.10 4.00 0.00 0.00%
metamorphosis Demonic Fury 145.65 -869.68 -5.97 -4.20 0.48%
shadowflame Demonic Fury 271.54 543.08 2.00 0.00 0.00%
soul_fire Demonic Fury 65.58 1967.34 30.00 0.00 0.00%
life_tap Mana 16.07 1181046.44 73511.25 0.00 0.00%
shadow_bolt Demonic Fury 66.46 1661.56 25.00 0.00 0.00%
mp5_regen Mana 1797.26 1811396.87 1007.87 0.00 0.00%
pet - doomguard
energy_regen Energy 239.00 726.45 3.04 171.45 19.09%
Resource RPS-Gain RPS-Loss
Health 0.00 2627.83
Mana 6658.18 7185.73
Demonic Fury 15.78 16.07
Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
blood_fury 4.3 0.0 120.9sec 120.9sec 14.05% 14.05%

Buff details

  • buff initial source:Warlock_Demonology_T14H_GoSac
  • cooldown name:buff_blood_fury
  • max_stacks:1
  • duration:15.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:spell_power
    • amount:2257.20

    Stack Uptimes

    • blood_fury_1:14.1%

Spelldata details

  • id:33702
  • name:Blood Fury
  • tooltip:Spell power increased by $s2.
  • description:Increases your spell power by $s2. Lasts $d.
  • max_stacks:
  • duration:15.00
  • cooldown:120.00
  • default_chance:0.00%
bloodlust 1.0 0.0 0.0sec 0.0sec 9.04% 14.67%

Buff details

  • buff initial source:Warlock_Demonology_T14H_GoSac
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • bloodlust_1:9.0%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell casting speed increased by $s1%.
  • description:Increases melee, ranged, and spell casting speed by $s1% for all party and raid members. Lasts $d. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for $57724d.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
dark_soul 6.1 0.0 80.9sec 80.9sec 26.35% 27.73%

Buff details

  • buff initial source:Warlock_Demonology_T14H_GoSac
  • cooldown name:buff_dark_soul
  • max_stacks:1
  • duration:20.00
  • cooldown:80.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • dark_soul_1:26.4%

Spelldata details

  • id:113861
  • name:Dark Soul: Knowledge
  • tooltip:Mastery increased by $s1.
  • description:Your soul is infused with demonic knowledge, increasing your Mastery by ${$113861m1} for $113861d.$?s56228[ |cFFFFFFFFPassive:|r Increases your Mastery by ${$113861m1/$56228m1}. This effect is disabled while on cooldown.][]
  • max_stacks:
  • duration:20.00
  • cooldown:120.00
  • default_chance:0.00%
demonic_calling 1.0 0.2 0.0sec 0.0sec 1.26% 0.39%

Buff details

  • buff initial source:Warlock_Demonology_T14H_GoSac
  • cooldown name:buff_demonic_calling
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • demonic_calling_1:1.3%

Spelldata details

  • id:114925
  • name:Demonic Calling
  • tooltip:Your next Shadow Bolt, Soul Fire,$?s114168[ Demonic Slash,][] or Touch of Chaos will summon a Wild Imp to attack the target.
  • description:Your next Shadow Bolt, Soul Fire,$?s114168[ Demonic Slash,][] or Touch of Chaos will summon a Wild Imp to attack the target.
  • max_stacks:1
  • duration:-0.00
  • cooldown:0.00
  • default_chance:1.00%
demonic_rebirth 1.0 0.0 0.0sec 0.0sec 4.52% 4.52%

Buff details

  • buff initial source:Warlock_Demonology_T14H_GoSac
  • cooldown name:buff_demonic_rebirth
  • max_stacks:1
  • duration:20.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • demonic_rebirth_1:4.5%

Spelldata details

  • id:88448
  • name:Demonic Rebirth
  • tooltip:Imp, Voidwalker, Succubus, Felhunter and Felguard casting time reduced by $*1;w1%.
  • description:If your summoned demon dies, you gain the Demonic Rebirth effect reducing the cast time of your next summon demon spell. Lasts for $88448d. This effect cannot occur more than once every $89140d.
  • max_stacks:
  • duration:20.00
  • cooldown:120.00
  • default_chance:1.00%
essence_of_terror 7.5 0.0 62.9sec 62.9sec 32.88% 32.88%

Buff details

  • buff initial source:Warlock_Demonology_T14H_GoSac
  • cooldown name:buff_essence_of_terror
  • max_stacks:1
  • duration:20.00
  • cooldown:60.00
  • default_chance:15.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:haste_rating
    • amount:7796.00

    Stack Uptimes

    • essence_of_terror_1:32.9%
jade_serpent_potion 2.0 0.0 360.9sec 0.0sec 10.18% 10.18%

Buff details

  • buff initial source:Warlock_Demonology_T14H_GoSac
  • cooldown name:buff_jade_serpent_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:intellect
    • amount:4000.00

    Stack Uptimes

    • jade_serpent_potion_1:10.2%
jade_spirit 8.7 0.0 54.0sec 54.0sec 22.86% 23.24%

Buff details

  • buff initial source:Warlock_Demonology_T14H_GoSac
  • cooldown name:buff_jade_spirit
  • max_stacks:1
  • duration:12.00
  • cooldown:50.00
  • default_chance:10.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:intellect
    • amount:1650.00
    • stat:spirit
    • amount:750.00

    Stack Uptimes

    • jade_spirit_1:22.9%
metamorphosis 29.8 0.0 15.3sec 15.3sec 34.12% 58.11%

Buff details

  • buff initial source:Warlock_Demonology_T14H_GoSac
  • cooldown name:buff_metamorphosis
  • max_stacks:1
  • duration:0.00
  • cooldown:10.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • metamorphosis_1:34.1%

Spelldata details

  • id:103958
  • name:Metamorphosis
  • tooltip:Demon Form. Damage dealt increased by $103958w2%.
  • description:Temporarily transform into a demon, increasing damage dealt by ${$104315m1*$m3/100+$77219m1*$m3/100}.2%. $?!s124917|!s124913[ Metamorphosis prevents the use of ][]$?!s124913[Corruption and ][]$?!s124917[Hand of Gul'dan.][]
  • max_stacks:
  • duration:-0.00
  • cooldown:10.00
  • default_chance:1.00%
molten_core 19.4 69.5 18.3sec 5.0sec 51.03% 100.00%

Buff details

  • buff initial source:Warlock_Demonology_T14H_GoSac
  • cooldown name:buff_molten_core
  • max_stacks:99
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • molten_core_1:18.3%
  • molten_core_2:8.1%
  • molten_core_3:4.7%
  • molten_core_4:3.4%
  • molten_core_5:2.9%
  • molten_core_6:2.6%
  • molten_core_7:2.3%
  • molten_core_8:2.0%
  • molten_core_9:1.7%
  • molten_core_10:1.4%
  • molten_core_11:1.1%
  • molten_core_12:0.8%
  • molten_core_13:0.6%
  • molten_core_14:0.4%
  • molten_core_15:0.3%
  • molten_core_16:0.2%
  • molten_core_17:0.1%
  • molten_core_18:0.1%
  • molten_core_19:0.0%
  • molten_core_20:0.0%
  • molten_core_21:0.0%
  • molten_core_22:0.0%
  • molten_core_23:0.0%
  • molten_core_24:0.0%
  • molten_core_25:0.0%
  • molten_core_26:0.0%
  • molten_core_27:0.0%

Spelldata details

  • id:122355
  • name:Molten Core
  • tooltip:The cast time and mana cost of Soul Fire is reduced by $w1%.$?($W3>0)[ Soul Fire grants $s3 additional Demonic Fury.][]
  • description:Reduces the cast time and mana cost of your next Soul Fire spell by $122355s1%. $?($m3>0)[Soul Fire grants $s3 additional Demonic Fury. ][] Lasts $d.
  • max_stacks:
  • duration:30.00
  • cooldown:0.00
  • default_chance:1.00%
relic_of_yulon 9.0 0.0 52.2sec 52.2sec 29.61% 29.61%

Buff details

  • buff initial source:Warlock_Demonology_T14H_GoSac
  • cooldown name:buff_relic_of_yulon
  • max_stacks:1
  • duration:15.00
  • cooldown:50.00
  • default_chance:20.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:intellect
    • amount:3027.00

    Stack Uptimes

    • relic_of_yulon_1:29.6%
synapse_springs_2 7.9 0.0 60.9sec 60.9sec 17.33% 17.33%

Buff details

  • buff initial source:Warlock_Demonology_T14H_GoSac
  • cooldown name:synapse_springs_2_hands
  • max_stacks:1
  • duration:10.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:intellect
    • amount:2940.00

    Stack Uptimes

    • synapse_springs_2_1:17.3%
Constant Buffs
attack_haste

Buff details

  • buff initial source:
  • cooldown name:buff_attack_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_haste_1:100.0%
attack_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.0%
critical_strike

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.0%
grimoire_of_sacrifice

Buff details

  • buff initial source:Warlock_Demonology_T14H_GoSac
  • cooldown name:buff_grimoire_of_sacrifice
  • max_stacks:1
  • duration:900.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • grimoire_of_sacrifice_1:100.0%

Spelldata details

  • id:108503
  • name:Grimoire of Sacrifice
  • tooltip:$?$w3>0[$@spelldesc132612][]$?$w4>0[$@spelldesc132613][]$?$w5>0[$@spelldesc132614][] $?s108415[ Maximum health increased by $108503s7%.][] Restores $108503s2% of maximum health every $108503t2 sec.
  • description:You sacrifice your demon to gain one of its abilities, increase the power of many of your single target spells by $?c0[$s5% to $s3][]$?c1[$s3][]$?c2[$s4][]$?c3[$s5][]%$?s108415[, increase your maximum health by $s7%,][] and regenerate $s2% of maximum health every $t2 sec. Lasts for $d. Summoning another demon cancels the effect.
  • max_stacks:
  • duration:900.00
  • cooldown:120.00
  • default_chance:0.00%
mastery

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.0%
spell_haste

Buff details

  • buff initial source:
  • cooldown name:buff_spell_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • spell_haste_1:100.0%
spell_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.0%
stamina

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.0%
str_agi_int

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.0%

Benefits & Uptimes

Benefits %%
Uptimes %%

Procs

Count Interval
wild_imp 8.5 51.7sec

Statistics & Data Analysis

Fight Length

Sample Data
Count 10000
Mean 449.44
Minimum 340.40
Maximum 563.02
Spread ( max - min ) 222.62
Range [ ( max - min ) / 2 * 100% ] 24.77%

DPS

Sample Data
Count 10000
Mean 123487.74
Minimum 112497.53
Maximum 138032.69
Spread ( max - min ) 25535.17
Range [ ( max - min ) / 2 * 100% ] 10.34%
Standard Deviation 3216.5037
5th Percentile 118459.27
95th Percentile 129039.52
( 95th Percentile - 5th Percentile ) 10580.25
Mean Distribution
Standard Deviation 32.1650
95.00% Confidence Intervall ( nan - nan )
Normalized 95.00% Confidence Intervall ( nan% - nan% )
Approx. Iterations needed for ( always use n>=50 )
1% Error -2147483648
0.1% Error -2147483648
0.1 Scale Factor Error with Delta=300 -2147483648
0.05 Scale Factor Error with Delta=300 -2147483648
0.01 Scale Factor Error with Delta=300 -2147483648
Distribution Chart

DPS(e)

Sample Data
Count 10000
Mean 123487.74

Damage

Sample Data
Count 10000
Mean 45823066.37

DTPS

Sample Data
Count 10000
Mean 0.00

HPS

Sample Data
Count 10000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( nan - nan )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 -2147483648
0.05 Scale Factor Error with Delta=300 -2147483648
0.01 Scale Factor Error with Delta=300 -2147483648
Distribution Chart

HPS(e)

Sample Data
Count 10000
Mean 0.00

Heal

Sample Data
Count 10000
Mean 0.00

HTPS

Sample Data
Count 10000
Mean 0.00

#Executed Foreground Actions

Sample Data
Count 10000
Mean 416.52
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat
# action,conditions
0 flask,type=warm_sun
1 food,type=mogu_fish_stew
2 dark_intent,if=!aura.spell_power_multiplier.up
3 summon_felguard
4 snapshot_stats
5 jade_serpent_potion
Default action list
# action,conditions
6 curse_of_the_elements,if=debuff.magic_vulnerability.down
7 use_item,name=shaskin_gloves
8 jade_serpent_potion,if=buff.bloodlust.react|target.health.pct<=20
9 blood_fury
A dark_soul
B service_felguard,if=talent.grimoire_of_service.enabled
C grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
D summon_felguard,if=talent.grimoire_of_sacrifice.enabled&buff.grimoire_of_sacrifice.down
E melee
F felguard:felstorm
G run_action_list,name=aoe,if=num_targets>5
H summon_doomguard
I corruption,cycle_targets=1,if=(!ticking|remains<tick_time)&target.time_to_die>=6&miss_react
J doom,cycle_targets=1,if=(!ticking|remains<tick_time|(ticks_remain+1<n_ticks&buff.dark_soul.up))&target.time_to_die>=30&miss_react
K metamorphosis,if=buff.dark_soul.up|dot.corruption.remains<5|demonic_fury>=900|demonic_fury>=target.time_to_die*30
L cancel_metamorphosis,if=dot.corruption.remains>15&buff.dark_soul.down&demonic_fury<=750&target.time_to_die>30
M imp_swarm
N hand_of_guldan,if=!in_flight&dot.shadowflame.remains<travel_time+action.shadow_bolt.cast_time
O soul_fire,if=buff.molten_core.react&(buff.metamorphosis.down|target.health.pct<25)
P touch_of_chaos
Q life_tap,if=mana.pct<50
R shadow_bolt
S fel_flame,moving=1
T life_tap

Sample Sequence

79ACHIKEJJMPPNRRRKEJPPPPPPPPPNOOONOOOOKEPPPPPPPNOOOOOOOKEPPPPPLNQQ7RRRRKEPPPPPNRRRAKEJPQNRRRIKEPPPRRNRMOOKEPPPPPLRNOOQR79OKEPPPPPLONOOQRORKEPPPPPPPLNRRRRQRKEJPAPPPPPPPNRKEPRNRRR7RKEPPPPNRRQRKEPPMRRRINRROROOQNRKEPPPPPLRRRNROKEJPPP9AP7PPPPPPPPPPNRKEPRRQRNRKEPPPPORRRKEPPPNMRRRKEPPPPPNOOOOO7KEJPPPPPPNOOOQQORAKEPJPPNRRQRIKEPPPNRORRORKEOPONOI8OQ9O7RONOQOOKEOOOMOPINOOOOOOOOKEOOOOOAJPINOKEPONOOQOKEOOO7OINOOQOOOOKEOOOPNO

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 158 150 80
Agility 162 154 80
Stamina 24548 22317 20183
Intellect 21165 18792 17713
Spirit 550 550 350
Health 490075 458841 0
Mana 300000 300000 0
Demonic Fury 1000 1000 0
Spell Power 31968 26689 7907
Spell Hit 15.01% 15.01% 5105
Spell Crit 19.45% 13.51% 2636
Spell Haste 24.48% 18.55% 7883
Mana Per 5 18671 17782 0
Attack Power 315 270 0
Melee Hit 15.01% 15.01% 5105
Melee Crit 12.22% 7.21% 2636
Melee Haste 18.55% 18.55% 7883
Swing Speed 30.40% 18.55% 7883
Expertise 0.00% 0.00% 0
Armor 14947 14947 14857
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 0.00% 0.00% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 17.95% 12.95% 2972

Talents

Level
15 Dark Regeneration Soul Leech Harvest Life
30 Howl of Terror Mortal Coil Shadowfury
45 Soul Link Sacrificial Pact Dark Bargain
60 Blood Fear Burning Rush Unbound Will
75 Grimoire of Supremacy Grimoire of Service Grimoire of Sacrifice
90 Archimonde's Vengeance Kil'jaeden's Cunning Mannoroth's Fury

Profile

#!./simc

warlock="Warlock_Demonology_T14H_GoSac"
origin="unknown"
level=90
race=orc
spec=demonology
role=spell
position=back
professions=engineering=600/enchanting=600
talents=http://us.battle.net/wow/en/game/mists-of-pandaria/feature/talent-specification#VZ!2...2.
talent_override=grimoire_of_sacrifice
glyphs=imp_swarm/shadow_bolt
actions.precombat=flask,type=warm_sun
actions.precombat+=/food,type=mogu_fish_stew
actions.precombat+=/dark_intent,if=!aura.spell_power_multiplier.up
actions.precombat+=/summon_felguard
actions.precombat+=/snapshot_stats
actions.precombat+=/jade_serpent_potion
actions=curse_of_the_elements,if=debuff.magic_vulnerability.down
actions+=/use_item,name=shaskin_gloves
actions+=/jade_serpent_potion,if=buff.bloodlust.react|target.health.pct<=20
actions+=/blood_fury
actions+=/dark_soul
actions+=/service_felguard,if=talent.grimoire_of_service.enabled
actions+=/grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
actions+=/summon_felguard,if=talent.grimoire_of_sacrifice.enabled&buff.grimoire_of_sacrifice.down
actions+=/melee
actions+=/felguard:felstorm
actions+=/run_action_list,name=aoe,if=num_targets>5
actions+=/summon_doomguard
actions+=/corruption,cycle_targets=1,if=(!ticking|remains=6&miss_react
actions+=/doom,cycle_targets=1,if=(!ticking|remains=30&miss_react
actions+=/metamorphosis,if=buff.dark_soul.up|dot.corruption.remains<5|demonic_fury>=900|demonic_fury>=target.time_to_die*30
actions+=/cancel_metamorphosis,if=dot.corruption.remains>15&buff.dark_soul.down&demonic_fury<=750&target.time_to_die>30
actions+=/imp_swarm
actions+=/hand_of_guldan,if=!in_flight&dot.shadowflame.remains actions+=/soul_fire,if=buff.molten_core.react&(buff.metamorphosis.down|target.health.pct<25)
actions+=/touch_of_chaos
actions+=/life_tap,if=mana.pct<50
actions+=/shadow_bolt
actions+=/fel_flame,moving=1
actions+=/life_tap
actions.aoe=summon_doomguard,if=num_targets<7
actions.aoe+=/summon_infernal,if=num_targets>=7
actions.aoe+=/imp_swarm,if=buff.metamorphosis.down
actions.aoe+=/corruption,cycle_targets=1,if=(!ticking|remains=6&miss_react
actions.aoe+=/hand_of_guldan
actions.aoe+=/metamorphosis,if=demonic_fury>=1000|demonic_fury>=31*target.time_to_die
actions.aoe+=/immolation_aura
actions.aoe+=/void_ray,if=dot.corruption.remains<10
actions.aoe+=/doom,cycle_targets=1,if=(!ticking|remains<40)&target.time_to_die>30&miss_react
actions.aoe+=/void_ray
actions.aoe+=/harvest_life,chain=1,if=talent.harvest_life.enabled
actions.aoe+=/hellfire,if=!talent.harvest_life.enabled
actions.aoe+=/life_tap
head=shaskin_hood,id=87188,gems=burning_primal_80int_160hit_180int,reforge=crit_haste
neck=amulet_of_seven_curses,id=87028,reforge=crit_haste
shoulders=shaskin_mantle,id=87191,gems=80int_160hit_60int,enchant=200int_100crit,reforge=mastery_haste
chest=shaskin_robes,id=87190,gems=80int_160haste_80int_160haste_180haste,enchant=80all,reforge=crit_mastery
waist=belt_of_malleable_amber,id=86981,gems=80int_160haste_80int_160hit_160int_120haste
legs=dreadwoven_leggings_of_failure,id=87174,gems=160int_80int_160hit_120int,enchant=285int_165crit
feet=sandals_of_the_blackest_night,id=87162,gems=80int_160haste_60mastery,enchant=140mastery
wrists=twisting_wind_bracers,id=86958,enchant=170int
hands=shaskin_gloves,id=87187,enchant=170haste,addon=synapse_springs_mark_ii
finger1=watersoul_signet,id=87151,enchant=160int,reforge=spi_mastery
finger2=fragment_of_fear_made_flesh,id=86949,enchant=160int,reforge=hit_haste
trinket1=essence_of_terror,id=87175
trinket2=relic_of_yulon,id=79331
back=cloak_of_overwhelming_corruption,id=87150,enchant=180int,reforge=mastery_hit
main_hand=loshan_terror_incarnate,id=87164,enchant=jade_spirit,reforge=crit_mastery
off_hand=tornadosummoning_censer,id=86960,enchant=165int,reforge=crit_haste
# Gear Summary
# gear_strength=80
# gear_agility=80
# gear_stamina=20183
# gear_intellect=17713
# gear_spirit=350
# gear_spell_power=7907
# gear_hit_rating=5105
# gear_crit_rating=2636
# gear_haste_rating=7883
# gear_mastery_rating=2972
# gear_armor=14857
# meta_gem=burning_primal
# tier14_2pc_caster=1
# tier14_4pc_caster=1
# hands=shaskin_gloves,heroic=1,addon=synapse_springs_mark_ii
# main_hand=loshan_terror_incarnate,heroic=1,weapon=sword_2.20speed_2880min_5349max,enchant=jade_spirit

Warlock_Demonology_T14H_GoSac_noToC : 126846 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active
126845.9 126845.9 nan / nan% 5194 / 4.1% 14.8 7127.9 6621.4 Mana 0.00% 52.2 100.0%
Talents http://us.battle.net/wow/en/game/mists-of-pandaria/feature/talent-specification#VZ!2...2.
Glyphs
  • imp_swarm
  • shadow_bolt

Charts

http://2.chart.apis.google.com/chart?chs=550x240&cht=bhg&chf=bg,s,333333&chd=t:949381|702177|95364|94166|90124|60905|20129&chds=0,1898761&chco=C79C6E,9482C9,FF6F00,435133,C41F3B,9482C9,9482C9&chm=t++949381++summon_doomguard,C79C6E,0,0,15|t++702177++doom,9482C9,1,0,15|t++95364++touch_of_chaos,FF6F00,2,0,15|t++94166++hand_of_guldan,435133,3,0,15|t++90124++soul_fire,C41F3B,4,0,15|t++60905++shadow_bolt,9482C9,5,0,15|t++20129++melee,9482C9,6,0,15&chtt=Warlock_Demonology_T14H_GoSac_noToC Damage Per Execute Time&&chts=dddddd,18 http://3.chart.apis.google.com/chart?chs=550x275&cht=p&chf=bg,s,333333&chd=t:25,21,18,17,14,10,7,4,3,2,0&chds=0,100&chdls=ffffff&chco=C41F3B,FF6F00,C41F3B,9482C9,9482C9,9482C9,9482C9,435133,435133,9482C9,C79C6E&chl=soul_fire|touch_of_chaos|wild_imp: firebolt|shadow_bolt|doom|corruption|melee|shadowflame|hand_of_guldan|doomguard: doom_bolt|felguard: legion_strike&chtt=Warlock_Demonology_T14H_GoSac_noToC Damage Sources&chts=dddddd,18
http://5.chart.apis.google.com/chart?chs=525x185&cht=lc&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chg=100,20&chd=s:ZZflruwxy002567778777550wrnkkhecaYYYZZYYXVVUWWWVVTUUVWWWWUUUWWWWWVVVXXXXXWWXYYZZaZZabbcddccccbaaaZZZZZZZZZYYYYXYYZaaaZZYYXXWWVUUVTTTTSSRRRRRRRRRRRRRRRRRRRRSTUVVWXYYZaabbccccdcbbaZYYXVVVVUTSSRQQQQRSTTUUUVVVVVWXXYZZZZZYXWWVVVUUTTSSRQPPQQRSSTUVWWXYYZaabbccbbaaaZZYXXWWVUUUTTTSSSSSSSSSSTTTTTUUUUUVWXXYZZZZYYXXXXXXXXXWWWVWWWXYYZabbcdeefffgffeedccbaZYYXWVUTTSRRRRRRRRRRRRRRSSSSSSSSTTUVVWXXYYZZabbccddeeeeeeefffffggggggggggggffedcbbaZZYXWVUUTTSSTTTSSSSSRRRRRRRSSSSSSRSSTUUUVVVVWVWWXYZabcefgghiklmnppqqqqponnlkjhgedbZYXWVUUTTTTTSTTTUUUUVVVVUUVVVVVVVUUUUUUUUUUUTTTTTTTTUUU&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=563|1:|0|avg=126846|max=305743&chxp=1,1,41,100&chtt=Warlock_Demonology_T14H_GoSac_noToC DPS Timeline&chts=dddddd,18 http://8.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chxs=0,ffffff|1,ffffff&chd=t:2,7,12,13,23,59,70,99,124,156,203,270,326,385,413,492,503,553,573,579,584,574,508,456,408,393,327,354,311,256,197,157,139,106,90,58,58,31,25,27,23,18,13,8,8,3,3,1,0,2&chds=0,584&chbh=5&chxt=x&chxl=0:|min=117607|avg=126846|max=139991&chxp=0,1,41,100&chtt=Warlock_Demonology_T14H_GoSac_noToC DPS Distribution&chts=dddddd,18 http://4.chart.apis.google.com/chart?chs=525x275&cht=p&chf=bg,s,333333&chd=t:28.9,28.7,23.2,7.9,4.1,3.7,2.1,1.2,0.3&chds=0,100&chdls=ffffff&chco=C41F3B,9482C9,FF6F00,435133,9482C9,9482C9,9482C9,C79C6E,C79C6E&chl=soul_fire 130.0s|shadow_bolt 128.8s|touch_of_chaos 104.1s|hand_of_guldan 35.3s|life_tap 18.5s|corruption 16.5s|doom 9.2s|imp_swarm 5.4s|summon_doomguard 1.2s&chtt=Warlock_Demonology_T14H_GoSac_noToC Spent Time&chts=dddddd,18

Abilities

Damage Stats DPS DPS%% Count Interval DPE DPET Hit Crit Avg Crit%% Avoid%% G%% B%% Ticks T-Hit T-Crit T-Avg T-Crit%% T-Avoid%% Up%%
Warlock_Demonology_T14H_GoSac_noToC 126846
blood_fury 0 0.0% 4.3 120.89sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: blood_fury

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 4.30 4.30 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
none 4.30 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: blood_fury

Static Values
  • id:33702
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:33702
  • name:Blood Fury
  • school:physical
  • tooltip:Spell power increased by $s2.
  • description:Increases your spell power by $s2. Lasts $d.
cancel_metamorphosis 0 0.0% 9.3 43.81sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: cancel_metamorphosis

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 9.33 9.33 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
none 9.33 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: cancel_metamorphosis

Static Values
  • id:0
  • school:unknown
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.dark_soul.down&demonic_fury<=750&target.time_to_die>30
corruption 10914 8.6% 13.9 33.36sec 352330 297173 0 0 0 0.0% 0.0% 0.0% 0.0% 295.2 13944 29089 16583 17.4% 0.0% 97.6%

Stats details: corruption

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 13.90 13.90 295.25 295.25 1.1856 1.4853 4896221.21 4896221.21 0.00 10761.07 297172.93
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 13.90 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 243.8 82.57% 13944.14 9002 27945 13962.02 12453 15567 3399517 3399517 0.00
crit 51.5 17.43% 29088.88 18544 57567 29124.54 23612 36475 1496704 1496704 0.00
DPS Timeline Chart

Action details: corruption

Static Values
  • id:172
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3750.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(!ticking|remains=6&miss_react
Spelldata
  • id:172
  • name:Corruption
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $?$W2=2[${$t1/2000}.2][$t1] sec.
  • description:Corrupts the target, causing $o3 Shadow damage over $d.$?a104315[ Generates 4 Demonic Fury each time it deals damage.][]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.200000
  • base_td:213.64
  • num_ticks:9
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_EXTEND
dark_soul 0 0.0% 6.1 80.87sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: dark_soul

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 6.05 6.05 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
none 6.05 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: dark_soul

Static Values
  • id:113861
  • school:shadow
  • resource:mana
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:15000.0
  • cooldown:80.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:113861
  • name:Dark Soul: Knowledge
  • school:shadow
  • tooltip:Mastery increased by $s1.
  • description:Your soul is infused with demonic knowledge, increasing your Mastery by ${$113861m1} for $113861d.$?s56228[ |cFFFFFFFFPassive:|r Increases your Mastery by ${$113861m1/$56228m1}. This effect is disabled while on cooldown.][]
doom 14442 11.4% 8.9 48.52sec 727592 702177 0 0 0 0.0% 0.0% 0.0% 0.0% 41.8 129511 271205 154821 17.9% 0.0% 98.2%

Stats details: doom

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 8.90 8.90 41.85 41.85 1.0362 10.5482 6478991.25 6478991.25 0.00 14376.93 702177.44
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 8.90 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 34.4 82.14% 129510.97 74714 177826 129629.86 110719 148003 4451707 4451707 0.00
crit 7.5 17.86% 271205.02 153911 366321 271203.72 0 366321 2027285 2027285 0.00
DPS Timeline Chart

Action details: doom

Static Values
  • id:603
  • school:shadow
  • resource:demonic_fury
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:60.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(!ticking|remains=30&miss_react
Spelldata
  • id:603
  • name:Doom
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $?$W2=2[${$t1/2000}.2][$t1] sec.
  • description:Inflicts impending doom upon the target, causing ${($m1+$SP*1)*4} Shadow damage over $d. When Doom critically strikes, a Wild Imp will be summoned to attack the target.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:1.400000
  • base_td:1495.48
  • num_ticks:4
  • base_tick_time:15.00
  • hasted_ticks:true
  • dot_behavior:DOT_EXTEND
hand_of_guldan 7412 5.8% 30.1 14.96sec 110407 94166 17954 37333 21311 17.3% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: hand_of_guldan

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 30.12 59.94 0.00 0.00 1.1725 0.0000 1277362.97 1277362.97 0.00 94165.64 94165.64
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 49.56 82.68% 17954.44 0 59726 17962.57 13110 23084 889799 889799 0.00
crit 10.38 17.32% 37332.93 0 123035 37335.53 0 90859 387564 387564 0.00
DPS Timeline Chart

Action details: hand_of_guldan

Static Values
  • id:105174
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:1.3000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:15000.0
  • cooldown:15.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!in_flight&dot.shadowflame.remains
Spelldata
  • id:105174
  • name:Hand of Gul'dan
  • school:shadow
  • tooltip:(null)
  • description:Summons a falling meteor to strike the target and all enemies within $86040A1 yards for $86040s1 Shadow damage and inflicting them with Shadowflame. $@spellicon47960 $@spellname47960 $@spelldesc47960
imp_swarm 0 0.0% 5.3 93.93sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: imp_swarm

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 5.25 5.25 0.00 0.00 1.0361 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
none 5.25 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: imp_swarm

Static Values
  • id:104316
  • school:physical
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:83.49
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:104316
  • name:Imp Swarm
  • school:physical
  • tooltip:(null)
  • description:Summons $104316s1 $104316lWild Imp:Wild Imps; from the Twisting Nether to attack the target. The Wild Imps passive effect is disabled while Imp Swarm is on cooldown. Imp Swarm's cooldown is reduced by spell haste. Also increases Wild Imp's cooldown by $s3 sec.
life_tap 0 0.0% 15.8 26.62sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: life_tap

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 15.84 15.84 0.00 0.00 1.1687 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
none 15.84 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: life_tap

Static Values
  • id:1454
  • school:shadow
  • resource:health
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:mana.pct<50
Spelldata
  • id:1454
  • name:Life Tap
  • school:shadow
  • tooltip:Absorbs $w3 healing.
  • description:$?s63320[Places a stacking heal absorb effect on you for $d equal to $m3% of your total health and restores][Restores] ${$m1*$MHP*0.01} mana.$?s63320[ Lasts $d.][]
melee 6997 5.5% 209.5 2.14sec 14988 20129 12670 26397 15083 17.6% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 209.49 208.17 0.00 0.00 0.7446 0.0000 3139832.98 3139832.98 0.00 20129.20 20129.20
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 171.58 82.42% 12669.71 8272 19689 12674.66 11799 13609 2173815 2173815 0.00
crit 36.60 17.58% 26396.53 17041 40559 26407.58 22115 30978 966018 966018 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:103988
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:103988
  • name:Melee
  • school:shadow
  • tooltip:(null)
  • description:Your melee attacks become long ranged and deal Shadow.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.100000
  • base_dd_min:101.48
  • base_dd_max:112.16
metamorphosis 0 0.0% 16.2 28.99sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: metamorphosis

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 16.19 16.19 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
none 16.19 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: metamorphosis

Static Values
  • id:103958
  • school:physical
  • resource:demonic_fury
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:10.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:103958
  • name:Metamorphosis
  • school:physical
  • tooltip:Demon Form. Damage dealt increased by $103958w2%.
  • description:Temporarily transform into a demon, increasing damage dealt by ${$104315m1*$m3/100+$77219m1*$m3/100}.2%. $?!s124917|!s124913[ Metamorphosis prevents the use of ][]$?!s124913[Corruption and ][]$?!s124917[Hand of Gul'dan.][]
shadow_bolt 17457 13.8% 205.0 4.99sec 38281 60905 32293 67102 38281 17.2% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 204.99 204.99 0.00 0.00 0.6285 0.0000 7847289.16 7847289.16 0.00 60905.35 60905.35
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 169.73 82.80% 32293.23 25051 73062 32299.99 30628 34275 5481249 5481249 0.00
crit 35.26 17.20% 67101.73 51606 150508 67118.47 56151 81129 2366040 2366040 0.00
DPS Timeline Chart

Action details: shadow_bolt

Static Values
  • id:686
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:16500.0
  • cooldown:0.00
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:686
  • name:Shadow Bolt
  • school:shadow
  • tooltip:(null)
  • description:Sends a shadowy bolt at the enemy, causing $s3 Shadow damage.$?a104315[ Generates 25 Demonic Fury.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:1.163000
  • base_dd_min:1242.32
  • base_dd_max:1242.32
shadowflame 4566 3.6% 30.0 14.97sec 68366 0 0 0 0 17.5% 0.0% 0.0% 0.0% 233.2 7391 15375 8784 17.4% 0.0% 37.9%

Stats details: shadowflame

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 29.96 29.96 233.19 233.19 0.0000 0.7299 2048284.86 2048284.86 0.00 12033.59 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 24.72 82.52% 0.00 0 0 0.00 0 0 0 0 0.00
crit 5.24 17.48% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 192.5 82.56% 7391.46 5605 20058 7397.65 6592 8724 1423071 1423071 0.00
crit 40.7 17.44% 15375.01 11546 40370 15383.90 12543 20211 625214 625214 0.00
DPS Timeline Chart

Action details: shadowflame

Static Values
  • id:47960
  • school:shadowflame
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:47960
  • name:Shadowflame
  • school:shadowflame
  • tooltip:Deals $w1 Shadowflame damage every $t1 sec. Movement speed reduced by $w2%.
  • description:Reduces movement speed by $47960s2% and deals $47960o1 Shadowflame damage over $47960d. Generates 2 Demonic Fury every time it deals damage.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.137000
  • base_td:146.34
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
soul_fire 26064 20.6% 84.6 5.15sec 138384 90124 0 139618 139618 100.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: soul_fire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 84.64 83.89 0.00 0.00 1.5355 0.0000 11712549.45 11712549.45 0.00 90124.26 90124.26
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
crit 83.89 100.00% 139618.11 106581 327621 139623.65 126892 155687 11712549 11712549 0.00
DPS Timeline Chart

Action details: soul_fire

Static Values
  • id:6353
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:24.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:45000.0
  • cooldown:0.00
  • base_execute_time:4.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.molten_core.react&(buff.metamorphosis.down|target.health.pct<25)
Spelldata
  • id:6353
  • name:Soul Fire
  • school:fire
  • tooltip:(null)
  • description:Burn the enemy's soul, causing $s1 Fire damage.$?s108869&1=0[ If used on a target below 25% health, the attack will trigger Molten Core.][] Soul Fire always critically strikes. In addition, the damage is increased by your critical strike chance.$?a104315&!a54879[ Generates 30 Demonic Fury.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:0.683000
  • base_dd_min:656.62
  • base_dd_max:802.54
summon_doomguard 2664 2.1% 1.0 nansec 1178182 949381 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: summon_doomguard

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 1.00 2.00 0.00 0.00 1.2410 0.0000 0.00 0.00 0.00 949380.75 949380.75
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
none 2.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: summon_doomguard

Static Values
  • id:18540
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:75000.0
  • cooldown:600.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:18540
  • name:Summon Doomguard
  • school:shadow
  • tooltip:(null)
  • description:Summons a Doomguard to attack the target for $60478d. Doomguard will cast Doom Bolt until it departs. $@spelltooltip85692
touch_of_chaos 22126 17.4% 100.5 4.22sec 98821 95364 83148 172856 98863 17.5% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: touch_of_chaos

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 100.50 100.46 0.00 0.00 1.0362 0.0000 9932003.05 9932003.05 0.00 95364.32 95364.32
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 82.86 82.48% 83148.38 53577 127518 83226.02 76920 89552 6889958 6889958 0.00
crit 17.60 17.52% 172856.26 110369 262687 173011.38 133301 209898 3042045 3042045 0.00
DPS Timeline Chart

Action details: touch_of_chaos

Static Values
  • id:103964
  • school:chaos
  • resource:demonic_fury
  • range:40.0
  • travel_speed:120.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:40.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:103964
  • name:Touch of Chaos
  • school:chaos
  • tooltip:(null)
  • description:Unleashes energy at the enemy, causing $s1 Chaos damage and extending the duration of Corruption.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.635000
  • base_dd_min:644.39
  • base_dd_max:712.22
pet - doomguard 19636 / 2664
doom_bolt 19636 2.1% 21.3 2.76sec 55274 19912 46486 96003 55274 17.7% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: doom_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 21.32 21.32 0.00 0.00 2.7759 0.0000 1178181.51 1178181.51 0.00 19911.81 19911.81
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 17.53 82.25% 46485.94 37536 70716 46475.09 40018 51911 815010 815010 0.00
crit 3.78 17.75% 96003.43 75072 141432 94302.94 0 141432 363171 363171 0.00
DPS Timeline Chart

Action details: doom_bolt

Static Values
  • id:85692
  • school:shadow
  • resource:energy
  • range:30.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:35.0
  • cooldown:0.00
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:85692
  • name:Doom Bolt
  • school:shadow
  • tooltip:(null)
  • description:Sends a shadowy bolt at the enemy, causing $s1 Shadow damage. Deals $s2% additional damage to targets below 20% health.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.900000
  • base_dd_min:913.31
  • base_dd_max:1009.45
pet - felguard 0 / 61
legion_strike 0 0.0% 1.0 nansec 26934 25998 22582 45165 26934 19.3% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% nan%

Stats details: legion_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 1.00 1.00 0.00 0.00 1.0360 0.0000 26934.02 26934.02 0.00 25998.08 25998.08
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 0.81 80.73% 22582.39 22582 22582 18230.76 0 22582 18231 18231 0.00
crit 0.19 19.27% 45164.78 45165 45165 8703.25 0 45165 8703 8703 0.00
DPS Timeline Chart

Action details: legion_strike

Static Values
  • id:30213
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:60.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:30213
  • name:Legion Strike
  • school:physical
  • tooltip:Effectiveness of any healing reduced by $w4%.
  • description:A sweeping attack that does $s2% of the Felguard's weapon damage divided among all targets within $A2 yards. The Felguard's current target is also wounded, reducing the effectiveness of any healing received by $s4% for $30213d.$?a104315[ Master gains $s3 Demonic Fury.][] |cFF777777(Right-Click to toggle)|r
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.25
pet - wild_imp 46391 / 18710
firebolt 46391 14.7% 338.3 1.38sec 24816 12177 23349 47683 27671 17.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: firebolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 338.34 303.42 0.00 0.00 2.0379 0.0000 8396037.01 8396037.01 0.00 12176.76 12176.76
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 249.53 82.24% 23349.30 19393 36536 23381.33 21972 25161 5826422 5826422 0.00
crit 53.89 17.76% 47683.30 38786 73072 47752.44 42408 55290 2569615 2569615 0.00
DPS Timeline Chart

Action details: firebolt

Static Values
  • id:104318
  • school:fire
  • resource:energy
  • range:40.0
  • travel_speed:16.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:104318
  • name:Firebolt
  • school:fire
  • tooltip:(null)
  • description:Deals $s1 Fire damage to a target.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.300000
  • base_dd_min:312.45
  • base_dd_max:328.47

Resources

Resource Usage Type Count Total Average RPE APR
Warlock_Demonology_T14H_GoSac_noToC
corruption Mana 13.9 52112.6 3750.0 3750.0 94.0
dark_soul Mana 6.1 90805.5 15000.0 15000.0 0.0
doom Demonic Fury 8.9 534.3 60.0 60.0 12126.5
hand_of_guldan Mana 30.1 451825.5 15000.0 15000.0 7.4
shadow_bolt Mana 68.3 1127468.1 16500.0 5500.0 7.0
soul_fire Mana 62.5 1406326.5 22502.0 16615.7 8.3
soul_fire Demonic Fury 22.1 1771.2 80.0 20.9 6612.7
summon_doomguard Mana 1.0 75000.0 75000.0 75000.0 15.7
touch_of_chaos Demonic Fury 100.5 4020.2 40.0 40.0 2470.5
pet - doomguard
doom_bolt Energy 21.3 746.0 35.0 35.0 1579.3
pet - felguard
legion_strike Energy 1.0 60.0 60.0 60.0 448.9
pet - wild_imp
firebolt Energy 338.3 338.3 1.0 1.0 24815.6
Resource Gains Type Count Total Average Overflow
felguard Demonic Fury 1.00 12.00 12.00 0.00 0.00%
wild_imp Demonic Fury 338.34 1691.41 5.00 0.28 0.02%
corruption Demonic Fury 309.14 1236.53 4.00 0.05 0.00%
metamorphosis Demonic Fury 143.42 -858.95 -5.99 -1.56 0.18%
shadowflame Demonic Fury 262.34 524.66 2.00 0.02 0.00%
soul_fire Demonic Fury 62.50 1874.91 30.00 0.03 0.00%
life_tap Mana 15.84 1164682.84 73511.25 0.00 0.00%
shadow_bolt Demonic Fury 68.33 1708.29 25.00 0.00 0.00%
mp5_regen Mana 1797.26 1811247.71 1007.78 28.94 0.00%
pet - doomguard
energy_regen Energy 239.00 726.77 3.04 171.12 19.06%
Resource RPS-Gain RPS-Loss
Health 0.00 2591.42
Mana 6621.44 7127.87
Demonic Fury 15.68 15.98
Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
blood_fury 4.3 0.0 120.9sec 120.9sec 14.05% 14.05%

Buff details

  • buff initial source:Warlock_Demonology_T14H_GoSac_noToC
  • cooldown name:buff_blood_fury
  • max_stacks:1
  • duration:15.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:spell_power
    • amount:2257.20

    Stack Uptimes

    • blood_fury_1:14.0%

Spelldata details

  • id:33702
  • name:Blood Fury
  • tooltip:Spell power increased by $s2.
  • description:Increases your spell power by $s2. Lasts $d.
  • max_stacks:
  • duration:15.00
  • cooldown:120.00
  • default_chance:0.00%
bloodlust 1.0 0.0 0.0sec 0.0sec 9.04% 14.25%

Buff details

  • buff initial source:Warlock_Demonology_T14H_GoSac_noToC
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • bloodlust_1:9.0%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell casting speed increased by $s1%.
  • description:Increases melee, ranged, and spell casting speed by $s1% for all party and raid members. Lasts $d. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for $57724d.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
dark_soul 6.1 0.0 80.8sec 80.9sec 26.36% 38.14%

Buff details

  • buff initial source:Warlock_Demonology_T14H_GoSac_noToC
  • cooldown name:buff_dark_soul
  • max_stacks:1
  • duration:20.00
  • cooldown:80.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • dark_soul_1:26.4%

Spelldata details

  • id:113861
  • name:Dark Soul: Knowledge
  • tooltip:Mastery increased by $s1.
  • description:Your soul is infused with demonic knowledge, increasing your Mastery by ${$113861m1} for $113861d.$?s56228[ |cFFFFFFFFPassive:|r Increases your Mastery by ${$113861m1/$56228m1}. This effect is disabled while on cooldown.][]
  • max_stacks:
  • duration:20.00
  • cooldown:120.00
  • default_chance:0.00%
demonic_calling 1.0 0.2 0.0sec 0.0sec 1.26% 0.39%

Buff details

  • buff initial source:Warlock_Demonology_T14H_GoSac_noToC
  • cooldown name:buff_demonic_calling
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • demonic_calling_1:1.3%

Spelldata details

  • id:114925
  • name:Demonic Calling
  • tooltip:Your next Shadow Bolt, Soul Fire,$?s114168[ Demonic Slash,][] or Touch of Chaos will summon a Wild Imp to attack the target.
  • description:Your next Shadow Bolt, Soul Fire,$?s114168[ Demonic Slash,][] or Touch of Chaos will summon a Wild Imp to attack the target.
  • max_stacks:1
  • duration:-0.00
  • cooldown:0.00
  • default_chance:1.00%
demonic_rebirth 1.0 0.0 0.0sec 0.0sec 4.52% 4.52%

Buff details

  • buff initial source:Warlock_Demonology_T14H_GoSac_noToC
  • cooldown name:buff_demonic_rebirth
  • max_stacks:1
  • duration:20.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • demonic_rebirth_1:4.5%

Spelldata details

  • id:88448
  • name:Demonic Rebirth
  • tooltip:Imp, Voidwalker, Succubus, Felhunter and Felguard casting time reduced by $*1;w1%.
  • description:If your summoned demon dies, you gain the Demonic Rebirth effect reducing the cast time of your next summon demon spell. Lasts for $88448d. This effect cannot occur more than once every $89140d.
  • max_stacks:
  • duration:20.00
  • cooldown:120.00
  • default_chance:1.00%
essence_of_terror 7.5 0.0 63.0sec 63.0sec 32.84% 32.84%

Buff details

  • buff initial source:Warlock_Demonology_T14H_GoSac_noToC
  • cooldown name:buff_essence_of_terror
  • max_stacks:1
  • duration:20.00
  • cooldown:60.00
  • default_chance:15.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:haste_rating
    • amount:7796.00

    Stack Uptimes

    • essence_of_terror_1:32.8%
jade_serpent_potion 2.0 0.0 360.9sec 0.0sec 10.18% 10.18%

Buff details

  • buff initial source:Warlock_Demonology_T14H_GoSac_noToC
  • cooldown name:buff_jade_serpent_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:intellect
    • amount:4000.00

    Stack Uptimes

    • jade_serpent_potion_1:10.2%
jade_spirit 8.7 0.0 54.1sec 54.1sec 22.84% 23.39%

Buff details

  • buff initial source:Warlock_Demonology_T14H_GoSac_noToC
  • cooldown name:buff_jade_spirit
  • max_stacks:1
  • duration:12.00
  • cooldown:50.00
  • default_chance:10.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:intellect
    • amount:1650.00
    • stat:spirit
    • amount:750.00

    Stack Uptimes

    • jade_spirit_1:22.8%
metamorphosis 16.2 0.0 29.0sec 29.0sec 33.27% 56.10%

Buff details

  • buff initial source:Warlock_Demonology_T14H_GoSac_noToC
  • cooldown name:buff_metamorphosis
  • max_stacks:1
  • duration:0.00
  • cooldown:10.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • metamorphosis_1:33.3%

Spelldata details

  • id:103958
  • name:Metamorphosis
  • tooltip:Demon Form. Damage dealt increased by $103958w2%.
  • description:Temporarily transform into a demon, increasing damage dealt by ${$104315m1*$m3/100+$77219m1*$m3/100}.2%. $?!s124917|!s124913[ Metamorphosis prevents the use of ][]$?!s124913[Corruption and ][]$?!s124917[Hand of Gul'dan.][]
  • max_stacks:
  • duration:-0.00
  • cooldown:10.00
  • default_chance:1.00%
molten_core 19.3 70.2 18.3sec 4.9sec 50.84% 100.00%

Buff details

  • buff initial source:Warlock_Demonology_T14H_GoSac_noToC
  • cooldown name:buff_molten_core
  • max_stacks:99
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • molten_core_1:19.0%
  • molten_core_2:8.0%
  • molten_core_3:4.5%
  • molten_core_4:3.3%
  • molten_core_5:2.8%
  • molten_core_6:2.5%
  • molten_core_7:2.3%
  • molten_core_8:2.0%
  • molten_core_9:1.7%
  • molten_core_10:1.4%
  • molten_core_11:1.1%
  • molten_core_12:0.8%
  • molten_core_13:0.6%
  • molten_core_14:0.4%
  • molten_core_15:0.3%
  • molten_core_16:0.1%
  • molten_core_17:0.1%
  • molten_core_18:0.1%
  • molten_core_19:0.0%
  • molten_core_20:0.0%
  • molten_core_21:0.0%
  • molten_core_22:0.0%
  • molten_core_23:0.0%
  • molten_core_24:0.0%
  • molten_core_25:0.0%
  • molten_core_26:0.0%
  • molten_core_27:0.0%
  • molten_core_28:0.0%
  • molten_core_29:0.0%
  • molten_core_30:0.0%
  • molten_core_31:0.0%

Spelldata details

  • id:122355
  • name:Molten Core
  • tooltip:The cast time and mana cost of Soul Fire is reduced by $w1%.$?($W3>0)[ Soul Fire grants $s3 additional Demonic Fury.][]
  • description:Reduces the cast time and mana cost of your next Soul Fire spell by $122355s1%. $?($m3>0)[Soul Fire grants $s3 additional Demonic Fury. ][] Lasts $d.
  • max_stacks:
  • duration:30.00
  • cooldown:0.00
  • default_chance:1.00%
relic_of_yulon 9.0 0.0 52.2sec 52.2sec 29.61% 29.61%

Buff details

  • buff initial source:Warlock_Demonology_T14H_GoSac_noToC
  • cooldown name:buff_relic_of_yulon
  • max_stacks:1
  • duration:15.00
  • cooldown:50.00
  • default_chance:20.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:intellect
    • amount:3027.00

    Stack Uptimes

    • relic_of_yulon_1:29.6%
synapse_springs_2 7.9 0.0 60.9sec 60.9sec 17.33% 17.33%

Buff details

  • buff initial source:Warlock_Demonology_T14H_GoSac_noToC
  • cooldown name:synapse_springs_2_hands
  • max_stacks:1
  • duration:10.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:intellect
    • amount:2940.00

    Stack Uptimes

    • synapse_springs_2_1:17.3%
Constant Buffs
attack_haste

Buff details

  • buff initial source:
  • cooldown name:buff_attack_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_haste_1:100.0%
attack_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.0%
critical_strike

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.0%
grimoire_of_sacrifice

Buff details

  • buff initial source:Warlock_Demonology_T14H_GoSac_noToC
  • cooldown name:buff_grimoire_of_sacrifice
  • max_stacks:1
  • duration:900.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • grimoire_of_sacrifice_1:100.0%

Spelldata details

  • id:108503
  • name:Grimoire of Sacrifice
  • tooltip:$?$w3>0[$@spelldesc132612][]$?$w4>0[$@spelldesc132613][]$?$w5>0[$@spelldesc132614][] $?s108415[ Maximum health increased by $108503s7%.][] Restores $108503s2% of maximum health every $108503t2 sec.
  • description:You sacrifice your demon to gain one of its abilities, increase the power of many of your single target spells by $?c0[$s5% to $s3][]$?c1[$s3][]$?c2[$s4][]$?c3[$s5][]%$?s108415[, increase your maximum health by $s7%,][] and regenerate $s2% of maximum health every $t2 sec. Lasts for $d. Summoning another demon cancels the effect.
  • max_stacks:
  • duration:900.00
  • cooldown:120.00
  • default_chance:0.00%
mastery

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.0%
spell_haste

Buff details

  • buff initial source:
  • cooldown name:buff_spell_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • spell_haste_1:100.0%
spell_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.0%
stamina

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.0%
str_agi_int

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.0%

Benefits & Uptimes

Benefits %%
Uptimes %%
Mana Cap 0.0%
felhunter-Mana Cap 0.0%
succubus-Mana Cap 0.0%
infernal-Mana Cap 0.0%
observer-Mana Cap 0.0%
shivarra-Mana Cap 0.0%
abyssal-Mana Cap 0.0%
felguard-Mana Cap 0.0%
wild_imp-Mana Cap 0.0%
wild_imp-Mana Cap 0.0%
wild_imp-Mana Cap 0.0%
wild_imp-Mana Cap 0.0%
wild_imp-Mana Cap 0.0%
wild_imp-Mana Cap 0.0%
wild_imp-Mana Cap 0.0%
wild_imp-Mana Cap 0.0%
wild_imp-Mana Cap 0.0%
wild_imp-Mana Cap 0.0%
wild_imp-Mana Cap 0.0%
wild_imp-Mana Cap 0.0%
wild_imp-Mana Cap 0.0%
wild_imp-Mana Cap 0.0%
wild_imp-Mana Cap 0.0%
service_felguard-Mana Cap 0.0%
service_imp-Mana Cap 0.0%
service_voidwalker-Mana Cap 0.0%

Procs

Count Interval
wild_imp 8.5 51.9sec

Statistics & Data Analysis

Fight Length

Sample Data
Count 10000
Mean 449.44
Minimum 340.40
Maximum 563.02
Spread ( max - min ) 222.62
Range [ ( max - min ) / 2 * 100% ] 24.77%

DPS

Sample Data
Count 10000
Mean 126845.92
Minimum 117606.69
Maximum 139991.44
Spread ( max - min ) 22384.75
Range [ ( max - min ) / 2 * 100% ] 8.82%
Standard Deviation 3170.2795
5th Percentile 121910.88
95th Percentile 132299.75
( 95th Percentile - 5th Percentile ) 10388.86
Mean Distribution
Standard Deviation 31.7028
95.00% Confidence Intervall ( nan - nan )
Normalized 95.00% Confidence Intervall ( nan% - nan% )
Approx. Iterations needed for ( always use n>=50 )
1% Error -2147483648
0.1% Error -2147483648
0.1 Scale Factor Error with Delta=300 -2147483648
0.05 Scale Factor Error with Delta=300 -2147483648
0.01 Scale Factor Error with Delta=300 -2147483648
Distribution Chart

DPS(e)

Sample Data
Count 10000
Mean 126845.92

Damage

Sample Data
Count 10000
Mean 47332534.93

DTPS

Sample Data
Count 10000
Mean 0.00

HPS

Sample Data
Count 10000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( nan - nan )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 -2147483648
0.05 Scale Factor Error with Delta=300 -2147483648
0.01 Scale Factor Error with Delta=300 -2147483648
Distribution Chart

HPS(e)

Sample Data
Count 10000
Mean 0.00

Heal

Sample Data
Count 10000
Mean 0.00

HTPS

Sample Data
Count 10000
Mean 0.00

#Executed Foreground Actions

Sample Data
Count 10000
Mean 391.05
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat
# action,conditions
0 flask,type=warm_sun
1 food,type=mogu_fish_stew
2 dark_intent,if=!aura.spell_power_multiplier.up
3 summon_felguard
4 snapshot_stats
5 jade_serpent_potion
Default action list
# action,conditions
6 curse_of_the_elements,if=debuff.magic_vulnerability.down
7 use_item,name=shaskin_gloves
8 jade_serpent_potion,if=buff.bloodlust.react|target.health.pct<=20
9 blood_fury
A dark_soul
B service_felguard,if=talent.grimoire_of_service.enabled
C grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
D summon_felguard,if=talent.grimoire_of_sacrifice.enabled&buff.grimoire_of_sacrifice.down
E melee
F felguard:felstorm
G run_action_list,name=aoe,if=num_targets>5
H summon_doomguard
I corruption,cycle_targets=1,if=(!ticking|remains<tick_time)&target.time_to_die>=6&miss_react
J doom,cycle_targets=1,if=(!ticking|remains<tick_time|(ticks_remain+1<n_ticks&buff.dark_soul.up))&target.time_to_die>=30&miss_react
K metamorphosis,if=buff.dark_soul.up|demonic_fury>=900|demonic_fury>=target.time_to_die*30
L cancel_metamorphosis,if=buff.dark_soul.down&demonic_fury<=750&target.time_to_die>30
M imp_swarm
N hand_of_guldan,if=!in_flight&dot.shadowflame.remains<travel_time+action.shadow_bolt.cast_time
O soul_fire,if=buff.molten_core.react&(buff.metamorphosis.down|target.health.pct<25)
P touch_of_chaos
Q life_tap,if=mana.pct<50
R shadow_bolt
S fel_flame,moving=1
T life_tap

Sample Sequence

79ACHIKEJJMPPNRROKEPJPPPPPLNOOORNROQRIRRRRNRQRORRRIRNRQR7KEPPPPPLRNRRRRKEPPPAJPPPPPPPPPPPPPPPPNRMNRRRROINRR9Q7ORORNRRIOQRRKEPPPPLNRRRORKEPPPJLNAQROKEPPPPPPPPPPPPPPPLN7RRRNRRRIOMRRNQRROOORIKEPPPPPPLNOQRRRRKEJPPPLN9RAR7OKEPPPPPPPPPPJPPPPPLNORRNQRRRIONRRMROQRROINOKEPPPPPP7LOONOOQKEPPPPLRRARKEJPPPJPPPPPPPPPPPPPNRRNOOOOOOI8N9OOO7OQOOONOQIOMOOOOKEOOOLNOQOIOKEOOAJOOOOOOOOOINOKEPNO7OOOQOONOIKEOOOPOOO

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 158 150 80
Agility 162 154 80
Stamina 24548 22317 20183
Intellect 21165 18792 17713
Spirit 550 550 350
Health 490075 458841 0
Mana 300000 300000 0
Demonic Fury 1000 1000 0
Spell Power 31968 26689 7907
Spell Hit 15.01% 15.01% 5105
Spell Crit 19.45% 13.51% 2636
Spell Haste 24.48% 18.55% 7883
Mana Per 5 18671 17782 0
Attack Power 315 270 0
Melee Hit 15.01% 15.01% 5105
Melee Crit 12.22% 7.21% 2636
Melee Haste 18.55% 18.55% 7883
Swing Speed 30.40% 18.55% 7883
Expertise 0.00% 0.00% 0
Armor 14947 14947 14857
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 0.00% 0.00% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 17.95% 12.95% 2972

Talents

Level
15 Dark Regeneration Soul Leech Harvest Life
30 Howl of Terror Mortal Coil Shadowfury
45 Soul Link Sacrificial Pact Dark Bargain
60 Blood Fear Burning Rush Unbound Will
75 Grimoire of Supremacy Grimoire of Service Grimoire of Sacrifice
90 Archimonde's Vengeance Kil'jaeden's Cunning Mannoroth's Fury

Profile

#!./simc

warlock="Warlock_Demonology_T14H_GoSac_noToC"
origin="unknown"
level=90
race=orc
spec=demonology
role=spell
position=back
professions=engineering=600/enchanting=600
talents=http://us.battle.net/wow/en/game/mists-of-pandaria/feature/talent-specification#VZ!2...2.
talent_override=grimoire_of_sacrifice
glyphs=imp_swarm/shadow_bolt
actions.precombat=flask,type=warm_sun
actions.precombat+=/food,type=mogu_fish_stew
actions.precombat+=/dark_intent,if=!aura.spell_power_multiplier.up
actions.precombat+=/summon_felguard
actions.precombat+=/snapshot_stats
actions.precombat+=/jade_serpent_potion
actions=curse_of_the_elements,if=debuff.magic_vulnerability.down
actions+=/use_item,name=shaskin_gloves
actions+=/jade_serpent_potion,if=buff.bloodlust.react|target.health.pct<=20
actions+=/blood_fury
actions+=/dark_soul
actions+=/service_felguard,if=talent.grimoire_of_service.enabled
actions+=/grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
actions+=/summon_felguard,if=talent.grimoire_of_sacrifice.enabled&buff.grimoire_of_sacrifice.down
actions+=/melee
actions+=/felguard:felstorm
actions+=/run_action_list,name=aoe,if=num_targets>5
actions+=/summon_doomguard
actions+=/corruption,cycle_targets=1,if=(!ticking|remains=6&miss_react
actions+=/doom,cycle_targets=1,if=(!ticking|remains=30&miss_react
actions+=/metamorphosis,if=buff.dark_soul.up|demonic_fury>=900|demonic_fury>=target.time_to_die*30
actions+=/cancel_metamorphosis,if=buff.dark_soul.down&demonic_fury<=750&target.time_to_die>30
actions+=/imp_swarm
actions+=/hand_of_guldan,if=!in_flight&dot.shadowflame.remains actions+=/soul_fire,if=buff.molten_core.react&(buff.metamorphosis.down|target.health.pct<25)
actions+=/touch_of_chaos
actions+=/life_tap,if=mana.pct<50
actions+=/shadow_bolt
actions+=/fel_flame,moving=1
actions+=/life_tap
actions.aoe=summon_doomguard,if=num_targets<7
actions.aoe+=/summon_infernal,if=num_targets>=7
actions.aoe+=/imp_swarm,if=buff.metamorphosis.down
actions.aoe+=/corruption,cycle_targets=1,if=(!ticking|remains=6&miss_react
actions.aoe+=/hand_of_guldan
actions.aoe+=/metamorphosis,if=demonic_fury>=1000|demonic_fury>=31*target.time_to_die
actions.aoe+=/immolation_aura
actions.aoe+=/void_ray,if=dot.corruption.remains<10
actions.aoe+=/doom,cycle_targets=1,if=(!ticking|remains<40)&target.time_to_die>30&miss_react
actions.aoe+=/void_ray
actions.aoe+=/harvest_life,chain=1,if=talent.harvest_life.enabled
actions.aoe+=/hellfire,if=!talent.harvest_life.enabled
actions.aoe+=/life_tap
head=shaskin_hood,id=87188,gems=burning_primal_80int_160hit_180int,reforge=crit_haste
neck=amulet_of_seven_curses,id=87028,reforge=crit_haste
shoulders=shaskin_mantle,id=87191,gems=80int_160hit_60int,enchant=200int_100crit,reforge=mastery_haste
chest=shaskin_robes,id=87190,gems=80int_160haste_80int_160haste_180haste,enchant=80all,reforge=crit_mastery
waist=belt_of_malleable_amber,id=86981,gems=80int_160haste_80int_160hit_160int_120haste
legs=dreadwoven_leggings_of_failure,id=87174,gems=160int_80int_160hit_120int,enchant=285int_165crit
feet=sandals_of_the_blackest_night,id=87162,gems=80int_160haste_60mastery,enchant=140mastery
wrists=twisting_wind_bracers,id=86958,enchant=170int
hands=shaskin_gloves,id=87187,enchant=170haste,addon=synapse_springs_mark_ii
finger1=watersoul_signet,id=87151,enchant=160int,reforge=spi_mastery
finger2=fragment_of_fear_made_flesh,id=86949,enchant=160int,reforge=hit_haste
trinket1=essence_of_terror,id=87175
trinket2=relic_of_yulon,id=79331
back=cloak_of_overwhelming_corruption,id=87150,enchant=180int,reforge=mastery_hit
main_hand=loshan_terror_incarnate,id=87164,enchant=jade_spirit,reforge=crit_mastery
off_hand=tornadosummoning_censer,id=86960,enchant=165int,reforge=crit_haste
# Gear Summary
# gear_strength=80
# gear_agility=80
# gear_stamina=20183
# gear_intellect=17713
# gear_spirit=350
# gear_spell_power=7907
# gear_hit_rating=5105
# gear_crit_rating=2636
# gear_haste_rating=7883
# gear_mastery_rating=2972
# gear_armor=14857
# meta_gem=burning_primal
# tier14_2pc_caster=1
# tier14_4pc_caster=1
# hands=shaskin_gloves,heroic=1,addon=synapse_springs_mark_ii
# main_hand=loshan_terror_incarnate,heroic=1,weapon=sword_2.20speed_2880min_5349max,enchant=jade_spirit

Warlock_Demonology_T14H_noToC : 123748 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active
123747.5 123747.5 nan / nan% 4718 / 3.8% 11.7 6741.1 6246.3 Mana 0.00% 55.8 100.0%
Talents http://us.battle.net/wow/en/game/mists-of-pandaria/feature/talent-specification#VZ!2...1.
Glyphs
  • imp_swarm
  • shadow_bolt

Charts

http://3.chart.apis.google.com/chart?chs=550x240&cht=bhg&chf=bg,s,333333&chd=t:949479|710043|81064|59634|58762|33095|12652&chds=0,1898957&chco=C79C6E,9482C9,435133,FF6F00,C41F3B,9482C9,9482C9&chm=t++949479++summon_doomguard,C79C6E,0,0,15|t++710043++doom,9482C9,1,0,15|t++81064++hand_of_guldan,435133,2,0,15|t++59634++touch_of_chaos,FF6F00,3,0,15|t++58762++soul_fire,C41F3B,4,0,15|t++33095++shadow_bolt,9482C9,5,0,15|t++12652++melee,9482C9,6,0,15&chtt=Warlock_Demonology_T14H_noToC Damage Per Execute Time&&chts=dddddd,18 http://4.chart.apis.google.com/chart?chs=550x275&cht=p&chf=bg,s,333333&chd=t:22,20,18,17,15,14,11,7,6,6,6,4,3,3,2,2&chds=0,100&chdls=ffffff&chco=C41F3B,FF6F00,9482C9,C79C6E,C41F3B,9482C9,9482C9,C79C6E,9482C9,C79C6E,435133,C79C6E,9482C9,C79C6E,435133,C79C6E&chl=soul_fire|touch_of_chaos|doom|felguard: melee|wild_imp: firebolt|corruption|shadow_bolt|felguard: felstorm|melee|felguard: legion_strike|shadowflame|service_felguard: melee|doomguard: doom_bolt|service_felguard: felstorm|hand_of_guldan|service_felguard: legion_strike&chtt=Warlock_Demonology_T14H_noToC Damage Sources&chts=dddddd,18
http://6.chart.apis.google.com/chart?chs=525x185&cht=lc&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chg=100,20&chd=s:ttvx24556656877764211zyvsokihfcbaXYXZZYYYWWVXXXXXVVVXXXXWUUUVVVVVTTTVVVVVUUUWWXXXWXXYYZbbZaaaZYYYYYXYYXXWWWVVVVVWXYYZZZZZZZYYYYZZZZZYXXWWVUUUUTTTTSSRRQQQQRRRSSTTUUVWWWXYYYYZZZYYYYXXVVUVUUTTSSRRQQQRRRSRSSSSSSSTUVVVVVVUUTTUUUUTTTTSRQQRRSTUWXYYYZZaabccdeefedccbaZYXXWWVVVVUUUTSSSSSSSSSSSTSSSSSSSSTUUVVVVVVUUVUVUUUVVVUUVVVWXXYYZZaaabccccccbaaZZYYXXWVVUTTSRRRRSSTUUVWWWWWXXXYYYYYYYYYYXXXXXXXXYYYYZZZZZZZZZZaaabbcccccccccdcccccbaZYYXXWVVUTTSSRRSSSRRRRRQQQRRRSSSSSSSSSTTUUUUUUUUTTUVWXYabcdefggijklmmnonnmllkihgfecbaYXWWVUTTSSSRRRRSSSSSTSSSSSSSTTTTTTTTTTTTTTTTTTTTTTTTTTT&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=563|1:|0|avg=123748|max=303811&chxp=1,1,41,100&chtt=Warlock_Demonology_T14H_noToC DPS Timeline&chts=dddddd,18 http://9.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chxs=0,ffffff|1,ffffff&chd=t:4,8,11,29,39,48,75,128,170,231,258,317,389,456,484,472,561,545,561,546,611,548,484,478,440,379,333,274,238,190,157,136,94,74,67,42,45,27,20,10,9,5,2,0,2,1,0,1,0,1&chds=0,611&chbh=5&chxt=x&chxl=0:|min=115463|avg=123748|max=136604&chxp=0,1,39,100&chtt=Warlock_Demonology_T14H_noToC DPS Distribution&chts=dddddd,18 http://5.chart.apis.google.com/chart?chs=525x275&cht=p&chf=bg,s,333333&chd=t:29.2,27.0,25.8,7.8,3.5,3.1,2.0,1.2,0.3&chds=0,100&chdls=ffffff&chco=C41F3B,FF6F00,9482C9,435133,9482C9,9482C9,9482C9,C79C6E,C79C6E&chl=soul_fire 131.2s|touch_of_chaos 121.2s|shadow_bolt 116.1s|hand_of_guldan 34.9s|life_tap 15.8s|corruption 14.1s|doom 9.2s|imp_swarm 5.4s|summon_doomguard 1.2s&chtt=Warlock_Demonology_T14H_noToC Spent Time&chts=dddddd,18

Abilities

Damage Stats DPS DPS%% Count Interval DPE DPET Hit Crit Avg Crit%% Avoid%% G%% B%% Ticks T-Hit T-Crit T-Avg T-Crit%% T-Avoid%% Up%%
Warlock_Demonology_T14H_noToC 123748
blood_fury 0 0.0% 4.3 120.92sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: blood_fury

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 4.30 4.30 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
none 4.30 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: blood_fury

Static Values
  • id:33702
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:33702
  • name:Blood Fury
  • school:physical
  • tooltip:Spell power increased by $s2.
  • description:Increases your spell power by $s2. Lasts $d.
cancel_metamorphosis 0 0.0% 12.8 31.30sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: cancel_metamorphosis

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 12.79 12.79 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
none 12.79 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: cancel_metamorphosis

Static Values
  • id:0
  • school:unknown
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.dark_soul.down&demonic_fury<=750&target.time_to_die>30
corruption 10972 8.9% 11.9 39.30sec 413252 348663 0 0 0 0.0% 0.0% 0.0% 0.0% 294.8 14038 29322 16698 17.4% 0.0% 97.1%

Stats details: corruption

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 11.91 11.91 294.77 294.77 1.1852 1.4809 4922079.91 4922079.91 0.00 10922.49 348663.31
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 11.91 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 243.5 82.59% 14037.70 9002 27945 14055.07 12780 15954 3417571 3417571 0.00
crit 51.3 17.41% 29322.12 18544 57567 29354.57 23986 35820 1504509 1504509 0.00
DPS Timeline Chart

Action details: corruption

Static Values
  • id:172
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3750.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(!ticking|remains=6&miss_react
Spelldata
  • id:172
  • name:Corruption
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $?$W2=2[${$t1/2000}.2][$t1] sec.
  • description:Corrupts the target, causing $o3 Shadow damage over $d.$?a104315[ Generates 4 Demonic Fury each time it deals damage.][]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.200000
  • base_td:213.64
  • num_ticks:9
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_EXTEND
dark_soul 0 0.0% 6.1 80.90sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: dark_soul

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 6.05 6.05 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
none 6.05 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: dark_soul

Static Values
  • id:113861
  • school:shadow
  • resource:mana
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:15000.0
  • cooldown:80.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:113861
  • name:Dark Soul: Knowledge
  • school:shadow
  • tooltip:Mastery increased by $s1.
  • description:Your soul is infused with demonic knowledge, increasing your Mastery by ${$113861m1} for $113861d.$?s56228[ |cFFFFFFFFPassive:|r Increases your Mastery by ${$113861m1/$56228m1}. This effect is disabled while on cooldown.][]
doom 14556 11.8% 8.9 48.63sec 735786 710043 0 0 0 0.0% 0.0% 0.0% 0.0% 41.9 130374 273623 155949 17.9% 0.0% 98.2%

Stats details: doom

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 8.87 8.87 41.87 41.87 1.0363 10.5452 6528848.14 6528848.14 0.00 14486.92 710043.30
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 8.87 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 34.4 82.15% 130374.00 74714 177826 130473.72 107123 148448 4483679 4483679 0.00
crit 7.5 17.85% 273623.17 153911 366321 273757.84 0 366321 2045169 2045169 0.00
DPS Timeline Chart

Action details: doom

Static Values
  • id:603
  • school:shadow
  • resource:demonic_fury
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:60.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(!ticking|remains=30&miss_react
Spelldata
  • id:603
  • name:Doom
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $?$W2=2[${$t1/2000}.2][$t1] sec.
  • description:Inflicts impending doom upon the target, causing ${($m1+$SP*1)*4} Shadow damage over $d. When Doom critically strikes, a Wild Imp will be summoned to attack the target.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:1.400000
  • base_td:1495.48
  • num_ticks:4
  • base_tick_time:15.00
  • hasted_ticks:true
  • dot_behavior:DOT_EXTEND
hand_of_guldan 6310 5.1% 29.8 15.03sec 94902 81064 11469 23954 13639 17.4% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: hand_of_guldan

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 29.84 59.38 0.00 0.00 1.1707 0.0000 809887.19 809887.19 0.00 81064.30 81064.30
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 49.06 82.62% 11468.82 0 38533 11472.63 8312 14354 562681 562681 0.00
crit 10.32 17.38% 23953.65 0 79377 23972.65 0 60759 247206 247206 0.00
DPS Timeline Chart

Action details: hand_of_guldan

Static Values
  • id:105174
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:1.3000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:15000.0
  • cooldown:15.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!in_flight&dot.shadowflame.remains
Spelldata
  • id:105174
  • name:Hand of Gul'dan
  • school:shadow
  • tooltip:(null)
  • description:Summons a falling meteor to strike the target and all enemies within $86040A1 yards for $86040s1 Shadow damage and inflicting them with Shadowflame. $@spellicon47960 $@spellname47960 $@spelldesc47960
imp_swarm 0 0.0% 5.2 93.96sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: imp_swarm

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 5.25 5.25 0.00 0.00 1.0362 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
none 5.25 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: imp_swarm

Static Values
  • id:104316
  • school:physical
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:96.40
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:104316
  • name:Imp Swarm
  • school:physical
  • tooltip:(null)
  • description:Summons $104316s1 $104316lWild Imp:Wild Imps; from the Twisting Nether to attack the target. The Wild Imps passive effect is disabled while Imp Swarm is on cooldown. Imp Swarm's cooldown is reduced by spell haste. Also increases Wild Imp's cooldown by $s3 sec.
life_tap 0 0.0% 13.6 31.15sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: life_tap

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 13.55 13.55 0.00 0.00 1.1654 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
none 13.55 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: life_tap

Static Values
  • id:1454
  • school:shadow
  • resource:health
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:mana.pct<50
Spelldata
  • id:1454
  • name:Life Tap
  • school:shadow
  • tooltip:Absorbs $w3 healing.
  • description:$?s63320[Places a stacking heal absorb effect on you for $d equal to $m3% of your total health and restores][Restores] ${$m1*$MHP*0.01} mana.$?s63320[ Lasts $d